SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL050W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YHL050W-A   Protein: S000028644
Sequence length 160
Comment YHL050W-A SGDID:S000028644, Chr VIII from 811-1293, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFLALFLVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKKFQIPYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences P0C5B8
YHL050W-A YHL050W-A YHL050W-A 4932.YHL050W-A YHL050W-A YHR219C-A YIL177W-A YJL225W-A YLL067W-A YML133W-B YNL339W-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]