SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL050W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHL050W-A   Protein: S000028644
Sequence length 160
Comment YHL050W-A SGDID:S000028644, Chr VIII from 811-1293, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFLALFLVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKKFQIPYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences P0C5B8
YHL050W-A YHR219C-A YIL177W-A YJL225W-A YLL067W-A YML133W-B YNL339W-B YHL050W-A 4932.YHL050W-A YHL050W-A YHL050W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]