SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR007C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR007C
Domain Number 1 Region: 52-524
Classification Level Classification E-value
Superfamily Cytochrome P450 2.1e-97
Family Cytochrome P450 1.53e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YHR007C   Protein: S000001049
Sequence length 530
Comment ERG11 SGDID:S000001049, Chr VIII from 121678-120086, reverse complement, Verified ORF, "Lanosterol 14-alpha-demethylase, catalyzes the C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in the ergosterol biosynthesis pathway; member of the cytochrome P450 family"
Sequence
MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYSLRKDRPPLVF
YWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADV
SAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRD
SKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPIN
FVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMT
DQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLL
QEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYF
PNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQL
GVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKIIWEKRNPEQKI
Download sequence
Identical sequences B3LSC7 B5VJT3 E7KP73 E7LV75 E7QFH7 H0GH31 P10614
YHR007C YHR007C 4932.YHR007C YHR007C YHR007C SCRT_04713 YHR007C YHR007C YHR007C YHR007C YHR007C SaceA.07054.d YHR007C

Jump to [ Top of page · Domain architecture · Domain assignment details ]