SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR007C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR007C
Domain Number 1 Region: 52-524
Classification Level Classification E-value
Superfamily Cytochrome P450 2.1e-97
Family Cytochrome P450 1.53e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
caveola 2.06 13.52
nuclear outer membrane-endoplasmic reticulum membrane network 1.559 11.99
endoplasmic reticulum part 1.433 10.29

Protein sequence

External link(s) Locus: YHR007C   Protein: S000001049
Sequence length 530
Comment ERG11 SGDID:S000001049, Chr VIII from 121678-120086, reverse complement, Verified ORF, "Lanosterol 14-alpha-demethylase, catalyzes the C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in the ergosterol biosynthesis pathway; member of the cytochrome P450 family"
Sequence
MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYSLRKDRPPLVF
YWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADV
SAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRD
SKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPIN
FVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMT
DQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLL
QEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYF
PNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQL
GVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKIIWEKRNPEQKI
Download sequence
Identical sequences B3LSC7 B5VJT3 E7KP73 E7LV75 E7QFH7 H0GH31 N1P1H0 P10614 W7PRN6 W7RJH1
YHR007C YHR007C 4932.YHR007C YHR007C YHR007C SCRT_04713 YHR007C YHR007C YHR007C YHR007C YHR007C SaceA.07054.d YHR007C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]