SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR013C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR013C
Domain Number 1 Region: 1-51,91-194
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.37e-20
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.418 11.12
perinuclear region of cytoplasm 1.481 5.79
nuclear chromosome 1.72 5.02
chromosomal part 1.477 5.02
chromatin 1.902 5.02

Protein sequence

External link(s) Locus: YHR013C   Protein: S000001055
Sequence length 238
Comment ARD1 SGDID:S000001055, Chr VIII from 131440-130724, reverse complement, Verified ORF, "Subunit of the N-terminal acetyltransferase NatA (Nat1p, Ard1p, Nat5p); N-terminally acetylates many proteins, which influences multiple processes such as the cell cycle, heat-shock resistance, mating, sporulation, and telomeric silencing"
Sequence
MPINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQ
DENDKLELTLDGTNDGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSV
MRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSY
YQDGEDAYAMKKVLKLEELQISNFTHRRLKENEEKLEDDLESDLLEDIIKQGVNDIIV
Download sequence
Identical sequences A6ZSR7 G2WF81 N1P9K9 P07347
YHR013C YHR013C 4932.YHR013C YHR013C YHR013C YHR013C tr|A6ZSR7|A6ZSR7_YEAS7 YHR013C 354914 CX00003 NYSGXRC-6355h YHR013C YHR013C YHR013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]