SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR013C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR013C
Domain Number 1 Region: 1-51,91-194
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.37e-20
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Protein sequence

External link(s) Locus: YHR013C   Protein: S000001055
Sequence length 238
Comment ARD1 SGDID:S000001055, Chr VIII from 131440-130724, reverse complement, Verified ORF, "Subunit of the N-terminal acetyltransferase NatA (Nat1p, Ard1p, Nat5p); N-terminally acetylates many proteins, which influences multiple processes such as the cell cycle, heat-shock resistance, mating, sporulation, and telomeric silencing"
Sequence
MPINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQ
DENDKLELTLDGTNDGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSV
MRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSY
YQDGEDAYAMKKVLKLEELQISNFTHRRLKENEEKLEDDLESDLLEDIIKQGVNDIIV
Download sequence
Identical sequences A6ZSR7 G2WF81 P07347
YHR013C YHR013C 4932.YHR013C YHR013C YHR013C YHR013C tr|A6ZSR7|A6ZSR7_YEAS7 YHR013C 354914 CX00003 NYSGXRC-6355h YHR013C YHR013C YHR013C

Jump to [ Top of page · Domain architecture · Domain assignment details ]