SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR032C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR032C-A   Protein: S000028646
Sequence length 39
Comment YHR032C-A SGDID:S000028646, Chr VIII from 175387-175268, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF YHR032W-A"
Sequence
MKGSKLFQMQKCMPVWCRTGTCIILPVACHMAKPLKLPT
Download sequence
Identical sequences C8ZAA3 Q8TGT5
YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A 4932.YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]