SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR032C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR032C-A   Protein: S000028646
Sequence length 39
Comment YHR032C-A SGDID:S000028646, Chr VIII from 175387-175268, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF YHR032W-A"
Sequence
MKGSKLFQMQKCMPVWCRTGTCIILPVACHMAKPLKLPT
Download sequence
Identical sequences C8ZAA3 Q8TGT5
YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A 4932.YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A YHR032C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]