SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YHR051W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR051W
Domain Number 1 Region: 46-145
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 2.62e-38
Family Cytochrome c oxidase subunit E 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
cellular respiration 1.869 12.94
generation of precursor metabolites and energy 1.508 10.87
oxidation-reduction process 1.418 6.36
electron transport chain 2.197 4.01
Cellular Component IC (bits) H-Score
mitochondrial inner membrane 1.751 13.38
mitochondrial envelope 1.57 11.3
organelle inner membrane 1.672 10.79

Protein sequence

External link(s) Locus: YHR051W   Protein: S000001093
Sequence length 148
Comment COX6 SGDID:S000001093, Chr VIII from 209699-210145, Verified ORF, "Subunit VI of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; expression is regulated by oxygen levels"
Sequence
MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEF
DEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQ
YKAYLDELKDVRQELGVPLKEELFPSSS
Download sequence
Identical sequences A6ZSV9 B3LSH0 C7GT91 C8ZAC2 E7KD69 E7KPB1 E7LVA8 E7NIG9 E7Q4M3 E7QFL3 G2WFC5 N1P1M2 P00427 W7PG16 W7QXW6
YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W YHR051W SCRT_04761 YHR051W YHR051W YHR051W tr|A6ZSV9|A6ZSV9_YEAS7 YHR051W YHR051W YHR051W YHR051W YHR051W 4932.YHR051W YHR051W YHR051W YHR051W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]