SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR054W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR054W-A
Domain Number - Region: 24-52
Classification Level Classification E-value
Superfamily YfgJ-like 0.00432
Family YfgJ-like 0.0071
Further Details:      
 

Protein sequence

External link(s) Locus: YHR054W-A   Protein: S000028648
Sequence length 64
Comment YHR054W-A SGDID:S000028648, Chr VIII from 214510-214704, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps CUP1-2"
Sequence
MNILKTIRFISQSSMTSWFLQTCYRRGICRRCYTPLGSYMIFGIVHYFCSYHIGIGTHDL
HFGS
Download sequence
Identical sequences C8Z9I9 P0CL32 P0CL33
YHR052W-A YHR054W-A YHR054W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A 4932.YHR052W-A 4932.YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]