SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR054W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR054W-A
Domain Number - Region: 24-52
Classification Level Classification E-value
Superfamily YfgJ-like 0.00432
Family YfgJ-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR054W-A   Protein: S000028648
Sequence length 64
Comment YHR054W-A SGDID:S000028648, Chr VIII from 214510-214704, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps CUP1-2"
Sequence
MNILKTIRFISQSSMTSWFLQTCYRRGICRRCYTPLGSYMIFGIVHYFCSYHIGIGTHDL
HFGS
Download sequence
Identical sequences C8Z9I9 P0CL32 P0CL33 W7PJN0
YHR052W-A YHR054W-A YHR054W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A 4932.YHR052W-A 4932.YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A YHR052W-A YHR054W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]