SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR056W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR056W-A   Protein: S000028777
Sequence length 144
Comment YHR056W-A SGDID:S000028777, Chr VIII from 217408-217842, Dubious ORF, "Dubious ORF unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNITTNGTTILTRSSIIIGVIILVASGLGPLHRSIHRGVEREVECLYRRLHNRILRLNHY
VFLIYTVSLTKMVGTLAIAVRGHPGRRGHSDHLTRSIWIKTVRLVILDAIPTYRFGPVAP
DLSLPALGASRRLPHFSHLHVHHD
Download sequence
Identical sequences YHR056W-A 4932.YHR056W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]