SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR073W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR073W-A   Protein: S000028834
Sequence length 58
Comment YHR073W-A SGDID:S000028834, Chr VIII from 242870-243046, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verified ORF YHR073W; identified by expression profiling and mass spectrometry"
Sequence
MDRIIRGKRDHILHCPLAAYSSNPRKYPYVKNSLRQDSLWSRGSATFPVTLWSKVILK
Download sequence
Identical sequences C8Z9L5 P0C5N7
YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A 4932.YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]