SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR073W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR073W-A   Protein: S000028834
Sequence length 58
Comment YHR073W-A SGDID:S000028834, Chr VIII from 242870-243046, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verified ORF YHR073W; identified by expression profiling and mass spectrometry"
Sequence
MDRIIRGKRDHILHCPLAAYSSNPRKYPYVKNSLRQDSLWSRGSATFPVTLWSKVILK
Download sequence
Identical sequences C8Z9L5 P0C5N7
YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A 4932.YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A YHR073W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]