SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YHR077C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR077C
Domain Number 1 Region: 574-784
Classification Level Classification E-value
Superfamily ARM repeat 1.22e-51
Family MIF4G domain-like 0.0000941
Further Details:      
 
Domain Number 2 Region: 376-561
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-44
Family MIF4G domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
membrane coat 2.106 28.56
trans-Golgi network 1.797 19.2
cytosol 1.305 13.34
mitochondrial envelope 1.57 11.82
mitochondrial membrane part 1.917 11.82
extrinsic to plasma membrane 1.991 10.49
adherens junction 1.365 9.56
cell-cell adherens junction 1.817 9.56
nucleoplasm part 1.419 9.55
methyltransferase complex 2.218 9.55

Protein sequence

External link(s) Locus: YHR077C   Protein: S000001119
Sequence length 1089
Comment NMD2 SGDID:S000001119, Chr VIII from 255758-255753,255639-252376, reverse complement, Verified ORF, "Protein involved in the nonsense-mediated mRNA decay (NMD) pathway; interacts with Nam7p and Upf3p; involved in telomere maintenance"
Sequence
MDDGRKKELHDLNTRAWNGEEVFPLKSKKLDSSIKRNTGFIKKLKKGFVKGSESSLLKDL
SEASLEKYLSEIIVTVTECLLNVLNKNDDVIAAVEIISGLHQRFNGRFTSPLLGAFLQAF
ENPSVDIESERDELQRITRVKGNLRVFTELYLVGVFRTLDDIESKDAIPNFLQKKTGRKD
PLLFSILREILNYKFKLGFTTTIATAFIKKFAPLFRDDDNSWDDLIYDSKLKGALQSLFK
NFIDATFARATELHKKVNKLQREHQKCQIRTGKLRDEYVEEYDKLLPIFIRFKTSAITLG
EFFKLEIPELEGASNDDLKETASPMITNQILPPNQRLWENEDTRKFYEILPDISKTVEES
QSSKTEKDSNVNSKNINLFFTDLEMADCKDIIDDLSNRYWSSYLDNKATRNRILKFFMET
QDWSKLPVYSRFIATNSKYMPEIVSEFINYLDNGFRSQLHSNKINVKNIIFFSEMIKFQL
IPSFMIFHKIRTLIMYMQVPNNVEILTVLLEHSGKFLLNKPEYKELMEKMVQLIKDKKND
RQLNMNMKSALENIITLLYPPSVKSLNVTVKTITPEQQFYRILIRSELSSLDFKHIVKLV
RKAHWDDVAIQKVLFSLFSKPHKISYQNIPLLTKVLGGLYSYRRDFVIRCIDQVLENIER
GLEINDYGQNMHRISNVRYLTEIFNFEMIKSDVLLDTIYHIIRFGHINNQPNPFYLNYSD
PPDNYFRIQLVTTILLNINRTPAAFTKKCKLLLRFFEYYTFIKEQPLPKETEFRVSSTFK
KYENIFGNTKFERSENLVESASRLESLLKSLNAIKSKDDRVKGSSASIHNGKESAVPIES
ITEDDEDEDDENDDGVDLLGEDEDAEISTPNTESAPGKHQAKQDESEDEDDEDDDEDDDD
DDDDDDDDGEEGDEDDDEDDDDEDDDDEEEEDSDSDLEYGGDLDADRDIEMKRMYEEYER
KLKDEEERKAEEELERQFQKMMQESIDARKSEKVVASKIPVISKPVSVQKPLLLKKSEEP
SSSKETYEELSKPKKIAFTFLTKSGKKTQSRILQLPTDVKFVSDVLEEEEKLKTERNKIK
KIVLKRSFD
Download sequence
Identical sequences P38798
YHR077C YHR077C YHR077C 4932.YHR077C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]