SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR077C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR077C
Domain Number 1 Region: 574-784
Classification Level Classification E-value
Superfamily ARM repeat 1.22e-51
Family MIF4G domain-like 0.0000941
Further Details:      
 
Domain Number 2 Region: 376-561
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-44
Family MIF4G domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
protein targeting 1.508 26.95
protein localization to organelle 1.46 26.95
protein import into nucleus 2.015 26.95
lipid biosynthetic process 1.45 24.21
cell division 1.424 19.32
mitotic cell cycle process 1.491 19.06
mitotic nuclear division 2.144 19.06
epithelial cell development 1.399 18.05
blood vessel morphogenesis 1.414 18.05
endothelium development 2.034 18.05
Cellular Component IC (bits) H-Score
membrane coat 2.107 29.29
transferase complex 1.423 23.98
trans-Golgi network 1.793 19.11
cytosol 1.301 13.3
side of membrane 1.701 12.74
extrinsic component of plasma membrane 1.992 12.34
chromosomal part 1.477 11.08
endocytic vesicle 1.433 10.75
clathrin-coated vesicle 2.107 10.75
adherens junction 1.365 9.56

Protein sequence

External link(s) Locus: YHR077C   Protein: S000001119
Sequence length 1089
Comment NMD2 SGDID:S000001119, Chr VIII from 255758-255753,255639-252376, reverse complement, Verified ORF, "Protein involved in the nonsense-mediated mRNA decay (NMD) pathway; interacts with Nam7p and Upf3p; involved in telomere maintenance"
Sequence
MDDGRKKELHDLNTRAWNGEEVFPLKSKKLDSSIKRNTGFIKKLKKGFVKGSESSLLKDL
SEASLEKYLSEIIVTVTECLLNVLNKNDDVIAAVEIISGLHQRFNGRFTSPLLGAFLQAF
ENPSVDIESERDELQRITRVKGNLRVFTELYLVGVFRTLDDIESKDAIPNFLQKKTGRKD
PLLFSILREILNYKFKLGFTTTIATAFIKKFAPLFRDDDNSWDDLIYDSKLKGALQSLFK
NFIDATFARATELHKKVNKLQREHQKCQIRTGKLRDEYVEEYDKLLPIFIRFKTSAITLG
EFFKLEIPELEGASNDDLKETASPMITNQILPPNQRLWENEDTRKFYEILPDISKTVEES
QSSKTEKDSNVNSKNINLFFTDLEMADCKDIIDDLSNRYWSSYLDNKATRNRILKFFMET
QDWSKLPVYSRFIATNSKYMPEIVSEFINYLDNGFRSQLHSNKINVKNIIFFSEMIKFQL
IPSFMIFHKIRTLIMYMQVPNNVEILTVLLEHSGKFLLNKPEYKELMEKMVQLIKDKKND
RQLNMNMKSALENIITLLYPPSVKSLNVTVKTITPEQQFYRILIRSELSSLDFKHIVKLV
RKAHWDDVAIQKVLFSLFSKPHKISYQNIPLLTKVLGGLYSYRRDFVIRCIDQVLENIER
GLEINDYGQNMHRISNVRYLTEIFNFEMIKSDVLLDTIYHIIRFGHINNQPNPFYLNYSD
PPDNYFRIQLVTTILLNINRTPAAFTKKCKLLLRFFEYYTFIKEQPLPKETEFRVSSTFK
KYENIFGNTKFERSENLVESASRLESLLKSLNAIKSKDDRVKGSSASIHNGKESAVPIES
ITEDDEDEDDENDDGVDLLGEDEDAEISTPNTESAPGKHQAKQDESEDEDDEDDDEDDDD
DDDDDDDDGEEGDEDDDEDDDDEDDDDEEEEDSDSDLEYGGDLDADRDIEMKRMYEEYER
KLKDEEERKAEEELERQFQKMMQESIDARKSEKVVASKIPVISKPVSVQKPLLLKKSEEP
SSSKETYEELSKPKKIAFTFLTKSGKKTQSRILQLPTDVKFVSDVLEEEEKLKTERNKIK
KIVLKRSFD
Download sequence
Identical sequences P38798
YHR077C YHR077C YHR077C 4932.YHR077C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]