SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR077C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR077C
Domain Number 1 Region: 574-784
Classification Level Classification E-value
Superfamily ARM repeat 1.22e-51
Family MIF4G domain-like 0.0000941
Further Details:      
 
Domain Number 2 Region: 376-561
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-44
Family MIF4G domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
nucleocytoplasmic transport 1.987 31.52
peptidyl-amino acid modification 1.432 22.31
peptidyl-lysine modification 1.895 22.31
cell cycle process 1.35 21.42
protein import 2.058 20.3
gliogenesis 1.492 18.6
nuclear division 1.865 17.9
microtubule-based process 1.532 15.82
regulation of cell activation 1.625 14.67
regulation of cell adhesion 1.406 14.67
Cellular Component IC (bits) H-Score
transferase complex 1.369 31.58
membrane coat 2.044 26.91
organelle envelope 1.405 21.18
cytosol 1.295 15.81
nucleoplasm part 1.369 10.12
methyltransferase complex 2.143 10.12
coated vesicle membrane 2.075 9.81
transport vesicle membrane 2.03 9.64
clathrin-coated vesicle 1.989 9.64
side of membrane 1.633 8.85

Protein sequence

External link(s) Locus: YHR077C   Protein: S000001119
Sequence length 1089
Comment NMD2 SGDID:S000001119, Chr VIII from 255758-255753,255639-252376, reverse complement, Verified ORF, "Protein involved in the nonsense-mediated mRNA decay (NMD) pathway; interacts with Nam7p and Upf3p; involved in telomere maintenance"
Sequence
MDDGRKKELHDLNTRAWNGEEVFPLKSKKLDSSIKRNTGFIKKLKKGFVKGSESSLLKDL
SEASLEKYLSEIIVTVTECLLNVLNKNDDVIAAVEIISGLHQRFNGRFTSPLLGAFLQAF
ENPSVDIESERDELQRITRVKGNLRVFTELYLVGVFRTLDDIESKDAIPNFLQKKTGRKD
PLLFSILREILNYKFKLGFTTTIATAFIKKFAPLFRDDDNSWDDLIYDSKLKGALQSLFK
NFIDATFARATELHKKVNKLQREHQKCQIRTGKLRDEYVEEYDKLLPIFIRFKTSAITLG
EFFKLEIPELEGASNDDLKETASPMITNQILPPNQRLWENEDTRKFYEILPDISKTVEES
QSSKTEKDSNVNSKNINLFFTDLEMADCKDIIDDLSNRYWSSYLDNKATRNRILKFFMET
QDWSKLPVYSRFIATNSKYMPEIVSEFINYLDNGFRSQLHSNKINVKNIIFFSEMIKFQL
IPSFMIFHKIRTLIMYMQVPNNVEILTVLLEHSGKFLLNKPEYKELMEKMVQLIKDKKND
RQLNMNMKSALENIITLLYPPSVKSLNVTVKTITPEQQFYRILIRSELSSLDFKHIVKLV
RKAHWDDVAIQKVLFSLFSKPHKISYQNIPLLTKVLGGLYSYRRDFVIRCIDQVLENIER
GLEINDYGQNMHRISNVRYLTEIFNFEMIKSDVLLDTIYHIIRFGHINNQPNPFYLNYSD
PPDNYFRIQLVTTILLNINRTPAAFTKKCKLLLRFFEYYTFIKEQPLPKETEFRVSSTFK
KYENIFGNTKFERSENLVESASRLESLLKSLNAIKSKDDRVKGSSASIHNGKESAVPIES
ITEDDEDEDDENDDGVDLLGEDEDAEISTPNTESAPGKHQAKQDESEDEDDEDDDEDDDD
DDDDDDDDGEEGDEDDDEDDDDEDDDDEEEEDSDSDLEYGGDLDADRDIEMKRMYEEYER
KLKDEEERKAEEELERQFQKMMQESIDARKSEKVVASKIPVISKPVSVQKPLLLKKSEEP
SSSKETYEELSKPKKIAFTFLTKSGKKTQSRILQLPTDVKFVSDVLEEEEKLKTERNKIK
KIVLKRSFD
Download sequence
Identical sequences P38798
NP_011944.2 4932.YHR077C YHR077C YHR077C YHR077C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]