SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR093W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR093W   Protein: S000001135
Sequence length 182
Comment AHT1 SGDID:S000001135, Chr VIII from 289145-289693, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; multicopy suppressor of glucose transport defects, likely due to the presence of an HXT4 regulatory element in the region"
Sequence
MDCKIKAAGKNSGIFHEGGTKSSKSFLTVFIRSVFPLSPSFPAGGGIWGPMEKKPGGVGK
KKGSEKKTAQGNIFFSTERDAGQEKCGILYKHCFSILYGFFWKKADKPKEKTGNGSGLGI
VFPIGQKKIPEPADSDIFLPCFRYAAASDFTKAKRFLVEITAVYWVSLEAQPSSASCLFI
LI
Download sequence
Identical sequences P29589
YHR093W 4932.YHR093W YHR093W YHR093W YHR093W YHR093W YT494 YHR093W YHR093W YHR093W YHR093W

Jump to [ Top of page · Domain architecture · Domain assignment details ]