SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR094C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR094C
Domain Number 1 Region: 69-271,302-525
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-62
Family LacY-like proton/sugar symporter 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
carbohydrate transport 2.202 59.96
ion transport 1.478 33.86
nitrogen compound transport 1.741 33.7
transmembrane transport 1.614 30.18
secretion 1.518 28.86
renal system process 1.887 28.86
synaptic vesicle cycle 2.221 16.87
neurotransmitter transport 2.134 16.87
cellular chemical homeostasis 1.528 15.74
ion homeostasis 1.497 15.74
Cellular Component IC (bits) H-Score
vacuolar part 1.508 14.07
cytoplasmic vesicle part 1.438 13.31
vesicle membrane 1.7 13.31
cell projection membrane 1.792 10.75
clathrin-coated vesicle 2.036 10.25
secretory vesicle 1.533 10.12
presynapse 1.761 9.44
integral component of plasma membrane 1.37 7.83
exocytic vesicle 2.005 6.94
brush border 1.358 6.66

Protein sequence

External link(s) Locus: YHR094C   Protein: S000001136
Sequence length 570
Comment HXT1 SGDID:S000001136, Chr VIII from 292628-290916, reverse complement, Verified ORF, "Low-affinity glucose transporter of the major facilitator superfamily, expression is induced by Hxk2p in the presence of glucose and repressed by Rgt1p when glucose is limiting"
Sequence
MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKG
VYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVS
IFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLG
VGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLG
LCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASV
EEMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSF
ETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQP
SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLIS
FFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASW
VPVSKRGADYNADDLMHDDQPFYKSLFSRK
Download sequence
Identical sequences A6ZT03 E7KDE9 P32465 W7Q2R5
YHR094C YHR094C YHR094C tr|A6ZT03|A6ZT03_YEAS7 YHR094C 2411S YHR094C YHR094C 4932.YHR094C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]