SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR094C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR094C
Domain Number 1 Region: 69-271,302-525
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-62
Family LacY-like proton/sugar symporter 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.462 17.19
vacuolar part 1.621 12.79
cell projection membrane 1.523 11.07
transport vesicle 2.075 9.9
clathrin-coated vesicle 2.107 9.9
cytoplasmic vesicle membrane 1.912 9.9
secretory granule 1.818 9.38
brush border 1.477 8.23
basolateral plasma membrane 1.896 7.88
sperm part 2.197 6.34

Protein sequence

External link(s) Locus: YHR094C   Protein: S000001136
Sequence length 570
Comment HXT1 SGDID:S000001136, Chr VIII from 292628-290916, reverse complement, Verified ORF, "Low-affinity glucose transporter of the major facilitator superfamily, expression is induced by Hxk2p in the presence of glucose and repressed by Rgt1p when glucose is limiting"
Sequence
MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKG
VYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVS
IFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLG
VGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLG
LCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASV
EEMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSF
ETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQP
SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLIS
FFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASW
VPVSKRGADYNADDLMHDDQPFYKSLFSRK
Download sequence
Identical sequences A6ZT03 E7KDE9 P32465 W7Q2R5
YHR094C YHR094C YHR094C tr|A6ZT03|A6ZT03_YEAS7 4932.YHR094C YHR094C YHR094C YHR094C 2411S

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]