SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR095W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR095W   Protein: S000001137
Sequence length 144
Comment YHR095W SGDID:S000001137, Chr VIII from 292946-293380, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNILFLIYLKDKRSARQCPAAFLPSFSEFPLRIGSCAHICQSFTEKKKEHWVTSEKLLTQ
CNSVIILCAVSLKKNQECKISINSLEVMMVSLSLTLLKKGFFSWSTLFRGKKKKKKKKKR
ILHVIYHDSTFLQAKMKIIRAHAK
Download sequence
Identical sequences P38808
YHR095W 4932.YHR095W YT495

Jump to [ Top of page · Domain architecture · Domain assignment details ]