SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YHR095W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR095W   Protein: S000001137
Sequence length 144
Comment YHR095W SGDID:S000001137, Chr VIII from 292946-293380, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNILFLIYLKDKRSARQCPAAFLPSFSEFPLRIGSCAHICQSFTEKKKEHWVTSEKLLTQ
CNSVIILCAVSLKKNQECKISINSLEVMMVSLSLTLLKKGFFSWSTLFRGKKKKKKKKKR
ILHVIYHDSTFLQAKMKIIRAHAK
Download sequence
Identical sequences YT495 4932.YHR095W YHR095W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]