SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR098C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR098C
Domain Number 1 Region: 31-201,536-631
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.96e-61
Family beta-sandwich domain of Sec23/24 0.0077
Further Details:      
 
Domain Number 2 Region: 295-524
Classification Level Classification E-value
Superfamily vWA-like 2.35e-53
Family Trunk domain of Sec23/24 0.00046
Further Details:      
 
Domain Number 3 Region: 738-902
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.83e-25
Family C-terminal, gelsolin-like domain of Sec23/24 0.0036
Further Details:      
 
Domain Number 4 Region: 207-286
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 8.76e-20
Family Zn-finger domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 636-737
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.0000000000000523
Family Helical domain of Sec23/24 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.383 46.09
protein complex involved in cell adhesion 2.216 43.99
transferase complex 1.334 20.65
transport vesicle membrane 2.001 20.55
membrane coat 2.031 20.39
focal adhesion 1.767 15.71
transporter complex 1.655 12.74
cytoplasmic vesicle part 1.377 11.98
actin cytoskeleton 1.332 11.48
plasma membrane receptor complex 1.776 10.9

Protein sequence

External link(s) Locus: YHR098C   Protein: S000001140
Sequence length 929
Comment SFB3 SGDID:S000001140, Chr VIII from 301937-299148, reverse complement, Verified ORF, "Member of the Sec24p family; forms a complex, with Sec23p, that is involved in sorting of Pma1p into COPII vesicles; peripheral ER membrane protein; potential Cdc28p substrate"
Sequence
MSQQNILAASVSALSLDESTVHTGGASSKKSRRPHRAYHNFSSGTVPTLGNSPYTTPQLN
QQDGFQQPQAFTPKQFGGFNNGSGSVMSTPVMVSQERFGASEASSPYGQSMLDMTAPQPT
SHIVPTQRFEDQAQYLQRSFETCRDSVPPLPTTQFYCVDQGSCDPHLMSLSMYNIPESEH
LRAATKLPLGLTIQPFSTLTPNDAEVPTIPLPMDGTPLRCRRCRAYANPKFQFTYDSSVI
CNICRVKMQVPGEHFAPMGPNGQRSDLNEKSELLHGTVDFLVPSIYNAIQEKELLPLHYV
FLIDVSLLANENGSSLAMVEGVRSCIEYISDFQPNCEVAIIVYDNKLRFFNLRPDLDNAQ
EYIVSELDDVFLPFYNGLFVKPGNSMKIINDTLIKISGYISTDKYSHVPQVCYGSALQAA
KLALDTVTGGQGGKIICSLNSLPTIGNGNLSLKRDNAHIAHVKCDNGFYKKLASDFLKSY
ISLDLYVTNAGFIDMATVGHPVEMTSGILKYYPHFQQETDAFTLVNDMVTNVSNIVGYQA
LLKVRCSTGLSVEQYYCDSSDNTDHDPIIPVLTRDTTLDVLLKYDSKIKTGTDVHFQTAL
LYTDIDGVRKVRSINTSGAVSNNIREIFKFINQNPVMRIMIKDVIKTLGDCDFVKIRRLI
DDKMVEILTQYRGLVSSNSSTQLILPDSIKTLPAYMLAFEKSELMKPNAQSTRGNERIYD
LLKYDSLNSAQLCYKLYPQIVPFHVLLEETDLTFYDANDKLLQINSSSINNLSVRASHSN
FINGGCYLIFQGDTIYLWFNENTNRMLLQDLLSVDESLPVSQISLFSGTLPETGTSINQK
ASNVIKNWQQVVNKSSLPLVLLRPNVDQYYSNVMSQLLCEDKTVNRIESYDNYLVIMHKK
IQEKLQKDDFIKVSTAATHENIHQKFVQF
Download sequence
Identical sequences N1P273 P38810
YHR098C YHR098C 4932.YHR098C YHR098C YHR098C YHR098C YHR098C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]