SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR098C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR098C
Domain Number 1 Region: 31-201,536-631
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.96e-61
Family beta-sandwich domain of Sec23/24 0.0077
Further Details:      
 
Domain Number 2 Region: 295-524
Classification Level Classification E-value
Superfamily vWA-like 2.35e-53
Family Trunk domain of Sec23/24 0.00046
Further Details:      
 
Domain Number 3 Region: 738-902
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.83e-25
Family C-terminal, gelsolin-like domain of Sec23/24 0.0036
Further Details:      
 
Domain Number 4 Region: 207-286
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 8.76e-20
Family Zn-finger domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 636-737
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 5.23e-14
Family Helical domain of Sec23/24 0.013
Further Details:      
 

Protein sequence

External link(s) Locus: YHR098C   Protein: S000001140
Sequence length 929
Comment SFB3 SGDID:S000001140, Chr VIII from 301937-299148, reverse complement, Verified ORF, "Member of the Sec24p family; forms a complex, with Sec23p, that is involved in sorting of Pma1p into COPII vesicles; peripheral ER membrane protein; potential Cdc28p substrate"
Sequence
MSQQNILAASVSALSLDESTVHTGGASSKKSRRPHRAYHNFSSGTVPTLGNSPYTTPQLN
QQDGFQQPQAFTPKQFGGFNNGSGSVMSTPVMVSQERFGASEASSPYGQSMLDMTAPQPT
SHIVPTQRFEDQAQYLQRSFETCRDSVPPLPTTQFYCVDQGSCDPHLMSLSMYNIPESEH
LRAATKLPLGLTIQPFSTLTPNDAEVPTIPLPMDGTPLRCRRCRAYANPKFQFTYDSSVI
CNICRVKMQVPGEHFAPMGPNGQRSDLNEKSELLHGTVDFLVPSIYNAIQEKELLPLHYV
FLIDVSLLANENGSSLAMVEGVRSCIEYISDFQPNCEVAIIVYDNKLRFFNLRPDLDNAQ
EYIVSELDDVFLPFYNGLFVKPGNSMKIINDTLIKISGYISTDKYSHVPQVCYGSALQAA
KLALDTVTGGQGGKIICSLNSLPTIGNGNLSLKRDNAHIAHVKCDNGFYKKLASDFLKSY
ISLDLYVTNAGFIDMATVGHPVEMTSGILKYYPHFQQETDAFTLVNDMVTNVSNIVGYQA
LLKVRCSTGLSVEQYYCDSSDNTDHDPIIPVLTRDTTLDVLLKYDSKIKTGTDVHFQTAL
LYTDIDGVRKVRSINTSGAVSNNIREIFKFINQNPVMRIMIKDVIKTLGDCDFVKIRRLI
DDKMVEILTQYRGLVSSNSSTQLILPDSIKTLPAYMLAFEKSELMKPNAQSTRGNERIYD
LLKYDSLNSAQLCYKLYPQIVPFHVLLEETDLTFYDANDKLLQINSSSINNLSVRASHSN
FINGGCYLIFQGDTIYLWFNENTNRMLLQDLLSVDESLPVSQISLFSGTLPETGTSINQK
ASNVIKNWQQVVNKSSLPLVLLRPNVDQYYSNVMSQLLCEDKTVNRIESYDNYLVIMHKK
IQEKLQKDDFIKVSTAATHENIHQKFVQF
Download sequence
Identical sequences P38810
YHR098C 4932.YHR098C YHR098C YHR098C YHR098C YHR098C YHR098C

Jump to [ Top of page · Domain architecture · Domain assignment details ]