SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR106W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR106W
Domain Number 1 Region: 24-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 2.99e-05
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
flavin adenine dinucleotide binding 1.989 62.38
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxyge 2.011 50.07
oxidoreductase activity, acting on NAD(P)H 1.919 44.4
oxidoreductase activity, acting on a sulfur group of donors 2.159 41.07
cofactor binding 1.606 31.27
lyase activity 1.474 15.92
hydro-lyase activity 1.989 15.92
nucleoside-triphosphatase regulator activity 1.534 11.18
electron carrier activity 2.004 9.06
monooxygenase activity 2.214 8.94
Cellular Component IC (bits) H-Score
organelle inner membrane 1.676 13.79
outer membrane 2.24 9.07
mitochondrial membrane part 1.918 8.31
mitochondrial envelope 1.579 7.08
mitochondrial inner membrane 1.756 6.85
intrinsic to organelle membrane 2.091 6.85
nuclear outer membrane-endoplasmic reticulum membrane network 1.56 4.63
nuclear envelope 1.695 4.63
nuclear membrane 2.219 4.63
respiratory chain 2.141 4.27
Biological Process IC (bits) H-Score
actin filament organization 1.653 23.41
oxidation-reduction process 1.416 22.76
positive regulation of transcription from RNA polymerase II promoter 1.476 16.47
small GTPase mediated signal transduction 1.882 15.35
small molecule catabolic process 1.624 14.98
purine-containing compound catabolic process 1.507 14.98
pyridine-containing compound metabolic process 2.135 14.67
response to inorganic substance 1.483 14.4
cellular response to oxygen-containing compound 1.294 13.56
chromatin organization 1.581 13.14

Protein sequence

External link(s) Locus: YHR106W   Protein: S000001148
Sequence length 342
Comment TRR2 SGDID:S000001148, Chr VIII from 325601-326629, Verified ORF, "Mitochondrial thioredoxin reductase involved in protection against oxidative stress, required with Glr1p to maintain the redox state of Trx3p; contains active-site motif (CAVC) present in prokaryotic orthologs; binds NADPH and FAD"
Sequence
MIKHIVSPFRTNFVGISKSVLSRMIHHKVTIIGSGPAAHTAAIYLARAEMKPTLYEGMMA
NGIAAGGQLTTTTDIENFPGFPESLSGSELMERMRKQSAKFGTNIITETVSKVDLSSKPF
RLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNKPL
AVIGGGDSACEEAEFLTKYASKVYILVRKDHFRASVIMQRRIEKNPNIIVLFNTVALEAK
GDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVKGQVDEEETGYIKTVPGSSL
TSVPGFFAAGDVQDSRYRQAVTSAGSGCIAALDAERYLSAQE
Download sequence
Identical sequences A6ZT14 B3LSM1 B5VK41 C7GLZ2 C8Z9P9 H0GHF3 P38816 W7PGC8 W7QXZ7
YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W 4932.YHR106W YHR106W SCRT_04820 YHR106W tr|A6ZT14|A6ZT14_YEAS7 YHR106W YHR106W YHR106W YHR106W YHR106W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]