SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YHR106W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR106W
Domain Number 1 Region: 24-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YHR106W   Protein: S000001148
Sequence length 342
Comment TRR2 SGDID:S000001148, Chr VIII from 325601-326629, Verified ORF, "Mitochondrial thioredoxin reductase involved in protection against oxidative stress, required with Glr1p to maintain the redox state of Trx3p; contains active-site motif (CAVC) present in prokaryotic orthologs; binds NADPH and FAD"
Sequence
MIKHIVSPFRTNFVGISKSVLSRMIHHKVTIIGSGPAAHTAAIYLARAEMKPTLYEGMMA
NGIAAGGQLTTTTDIENFPGFPESLSGSELMERMRKQSAKFGTNIITETVSKVDLSSKPF
RLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQQGISACAVCDGAVPIFRNKPL
AVIGGGDSACEEAEFLTKYASKVYILVRKDHFRASVIMQRRIEKNPNIIVLFNTVALEAK
GDGKLLNMLRIKNTKSNVENDLEVNGLFYAIGHSPATDIVKGQVDEEETGYIKTVPGSSL
TSVPGFFAAGDVQDSRYRQAVTSAGSGCIAALDAERYLSAQE
Download sequence
Identical sequences A6ZT14 B3LSM1 B5VK41 C7GLZ2 C8Z9P9 H0GHF3 P38816 W7PGC8 W7QXZ7
YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W YHR106W 4932.YHR106W YHR106W YHR106W YHR106W YHR106W tr|A6ZT14|A6ZT14_YEAS7 YHR106W SCRT_04820 YHR106W YHR106W YHR106W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]