SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR128W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR128W
Domain Number 1 Region: 6-214
Classification Level Classification E-value
Superfamily PRTase-like 8.05e-65
Family Phosphoribosyltransferases (PRTases) 5.99e-07
Further Details:      
 

Protein sequence

External link(s) Locus: YHR128W   Protein: S000001170
Sequence length 216
Comment FUR1 SGDID:S000001170, Chr VIII from 362118-362768, Verified ORF, "Uracil phosphoribosyltransferase, synthesizes UMP from uracil; involved in the pyrimidine salvage pathway"
Sequence
MSSEPFKNVYLLPQTNQLLGLYTIIRNKNTTRPDFIFYSDRIIRLLVEEGLNHLPVQKQI
VETDTNENFEGVSFMGKICGVSIVRAGESMEQGLRDCCRSVRIGKILIQRDEETALPKLF
YEKLPEDISERYVFLLDPMLATGGSAIMATEVLIKRGVKPERIYFLNLICSKEGIEKYHA
AFPEVRIVTGALDRGLDENKYLVPGLGDFGDRYYCV
Download sequence
Identical sequences A6ZT35 B3LSP2 C7GR72 C8Z9S1 E7KPH5 E7Q4S4 G2WFK1 H0GHH0 P18562
YHR128W YHR128W YHR128W YHR128W YHR128W YHR128W YHR128W YHR128W YHR128W YHR128W YHR128W 4932.YHR128W YHR128W SCRT_04841 YHR128W YHR128W YHR128W tr|A6ZT35|A6ZT35_YEAS7 YHR128W YHR128W YHR128W YHR128W YHR128W

Jump to [ Top of page · Domain architecture · Domain assignment details ]