SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR134W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR134W   Protein: S000001176
Sequence length 269
Comment WSS1 SGDID:S000001176, Chr VIII from 371752-372561, Verified ORF, "Sumoylated protein of unknown function, identified based on genetic interactions with SMT3; UV-sensitive mutant phenotype and genetic interactions suggest a role in the DNA damage response, processing stalled or collapsed replication forks"
Sequence
MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMK
ENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHN
LFGPHDKKFYNKLDELIGRQWVIEQRGLYDTFLGNGQRLGGRANLRSNRYPMTGISTNTG
IVRKRGKGVKLGSLHPEGISSIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDN
ISSSLEVVILDDDDEVLPGDTLIEVIDLT
Download sequence
Identical sequences C7GTW1 C8Z9S9 E7KPI0 E7LVG6 N1P2U5 P38838 W7PGH2
YHR134W 4932.YHR134W YHR134W YHR134W YHR134W YHR134W YT499 YHR134W YHR134W YHR134W

Jump to [ Top of page · Domain architecture · Domain assignment details ]