SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR137C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR137C-A   Protein: S000028649
Sequence length 216
Comment YHR137C-A SGDID:S000028649, Chr VIII from 376391-375741, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps verified gene ARO9/YHR137W; identified by gene-trapping, expression analysis, and genome-wide homology searching"
Sequence
MVYRTLGLFKSLYGPVDQLSSNCVRYSTSIPWDSLSKVRFILMGMTFAPVASTLDIAGVK
VNSSIITVVDSSQIVSKTLNIESLDPPERMTSQLDSVSSEKAGRLILDTKSLTKCKRGGK
PLVSAYWKERAMGSSLGDPKSKCAVVNELCHFGLSLKGTFDIFKSIDSIGKNLSFGIPPA
SSMTSSEISEASQKLFRDLFSTLLERNGWKFFFKEV
Download sequence
Identical sequences Q8TGN6
YHR137C-A YHR137C-A 4932.YHR137C-A YHR137C-A YHR137C-A YHR137C-A YHR137C-A YHR137C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]