SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR137C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR137C-A   Protein: S000028649
Sequence length 216
Comment YHR137C-A SGDID:S000028649, Chr VIII from 376391-375741, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps verified gene ARO9/YHR137W; identified by gene-trapping, expression analysis, and genome-wide homology searching"
Sequence
MVYRTLGLFKSLYGPVDQLSSNCVRYSTSIPWDSLSKVRFILMGMTFAPVASTLDIAGVK
VNSSIITVVDSSQIVSKTLNIESLDPPERMTSQLDSVSSEKAGRLILDTKSLTKCKRGGK
PLVSAYWKERAMGSSLGDPKSKCAVVNELCHFGLSLKGTFDIFKSIDSIGKNLSFGIPPA
SSMTSSEISEASQKLFRDLFSTLLERNGWKFFFKEV
Download sequence
Identical sequences Q8TGN6
YHR137C-A YHR137C-A 4932.YHR137C-A YHR137C-A YHR137C-A YHR137C-A YHR137C-A YHR137C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]