SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR148W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR148W
Domain Number 1 Region: 27-175
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 6.28e-23
Family Ribosomal protein S4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.977 89.69
intramolecular transferase activity 2.226 25.18
structural constituent of ribosome 1.983 13.8
isomerase activity 1.669 12.15
RNA binding 1.361 4.14
Cellular Component IC (bits) H-Score
ribosomal subunit 2.011 13.52
ribonucleoprotein complex 1.415 11.2
organellar ribosome 2.149 8
cytosol 1.305 6.57
mitochondrial matrix 1.716 4.2
cytosolic ribosome 2.218 3.98
Biological Process IC (bits) H-Score
RNA processing 1.457 74.16
rRNA metabolic process 2.197 74.16
ncRNA processing 1.878 74.16
ribosome biogenesis 2.068 21.03
tRNA aminoacylation 2.003 17.34
RNA modification 2.179 9.99
translation 1.522 9.15
ncRNA metabolic process 1.572 6.34
mitochondrion organization 1.553 4.78

Protein sequence

External link(s) Locus: YHR148W   Protein: S000001191
Sequence length 183
Comment IMP3 SGDID:S000001191, Chr VIII from 393537-394088, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, essential protein that interacts with Mpp10p and mediates interactions of Imp4p and Mpp10p with U3 snoRNA"
Sequence
MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANK
LSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKM
AETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDF
DFS
Download sequence
Identical sequences A6ZT56 B3LSR2 B5VK78 C7GJZ0 C8Z9U5 E7KPJ2 E7LVH6 E7NIP2 E7Q4T9 E7QFR2 G2WFM1 H0GHI6 N1P4S5 P32899 W7PGI5 W7R1Q5
YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W 4932.YHR148W YHR148W SCRT_04861 YHR148W tr|A6ZT56|A6ZT56_YEAS7 YHR148W YHR148W YHR148W YHR148W YHR148w___KOG4655 YHR148W YHR148W YHR148W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]