SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR148W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR148W
Domain Number 1 Region: 27-175
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 6.28e-23
Family Ribosomal protein S4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.948 10.55
intracellular ribonucleoprotein complex 1.323 8.52
mitochondrial matrix 1.568 8.09
mitochondrial ribosome 2.079 8.09
cytosolic ribosome 2.062 5.47
cytosolic part 1.678 5.32
Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.893 105.58
intramolecular transferase activity 2.107 29.62
isomerase activity 1.598 14.22
structural constituent of ribosome 1.965 13.35
RNA binding 1.279 4.24
Biological Process IC (bits) H-Score
RNA processing 1.497 74.65
ncRNA processing 1.821 74.65
ribosome biogenesis 1.945 25.45
RNA modification 2.202 12.04
translation 1.516 9.07
ncRNA metabolic process 1.499 6.29
mitochondrion organization 1.534 4.5
mitochondrial RNA metabolic process 2.241 4.26
rRNA metabolic process 2.134 3.57
tRNA aminoacylation for protein translation 1.966 3.42

Protein sequence

External link(s) Locus: YHR148W   Protein: S000001191
Sequence length 183
Comment IMP3 SGDID:S000001191, Chr VIII from 393537-394088, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, essential protein that interacts with Mpp10p and mediates interactions of Imp4p and Mpp10p with U3 snoRNA"
Sequence
MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANK
LSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKM
AETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDF
DFS
Download sequence
Identical sequences A6ZT56 B3LSR2 B5VK78 C7GJZ0 C8Z9U5 E7KPJ2 E7LVH6 E7NIP2 E7Q4T9 E7QFR2 G2WFM1 H0GHI6 N1P4S5 P32899 W7PGI5 W7R1Q5
YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148w___KOG4655 YHR148W YHR148W YHR148W YHR148W SCRT_04861 YHR148W tr|A6ZT56|A6ZT56_YEAS7 YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W 4932.YHR148W YHR148W YHR148W YHR148W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]