SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR148W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR148W
Domain Number 1 Region: 27-175
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 6.28e-23
Family Ribosomal protein S4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.939 10.37
intracellular ribonucleoprotein complex 1.329 8.36
mitochondrial matrix 1.568 7.46
organellar ribosome 2.064 6.31
cytosolic part 1.704 5.44
cytosolic ribosome 2.192 4.21
Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.828 107.72
intramolecular transferase activity 2.118 28.92
structural constituent of ribosome 1.946 15.65
isomerase activity 1.585 13.81
Biological Process IC (bits) H-Score
tRNA aminoacylation for protein translation 1.932 107.72
RNA processing 1.496 73.44
rRNA metabolic process 2.096 73.44
ncRNA processing 1.829 73.44
ribosome biogenesis 1.84 25.77
ribonucleoprotein complex biogenesis 1.694 22.08
RNA modification 2.2 11.7
translation 1.507 9.87
ncRNA metabolic process 1.489 6.22

Protein sequence

External link(s) Locus: YHR148W   Protein: S000001191
Sequence length 183
Comment IMP3 SGDID:S000001191, Chr VIII from 393537-394088, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, essential protein that interacts with Mpp10p and mediates interactions of Imp4p and Mpp10p with U3 snoRNA"
Sequence
MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANK
LSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKM
AETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDF
DFS
Download sequence
Identical sequences A6ZT56 B3LSR2 B5VK78 C7GJZ0 C8Z9U5 E7KPJ2 E7LVH6 E7NIP2 E7Q4T9 E7QFR2 G2WFM1 H0GHI6 N1P4S5 P32899 W7PGI5 W7R1Q5
SCRT_04861 tr|A6ZT56|A6ZT56_YEAS7 YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148w___KOG4655 YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W 4932.YHR148W YHR148W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]