SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR148W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR148W
Domain Number 1 Region: 27-175
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 6.28e-23
Family Ribosomal protein S4 0.026
Further Details:      
 

Protein sequence

External link(s) Locus: YHR148W   Protein: S000001191
Sequence length 183
Comment IMP3 SGDID:S000001191, Chr VIII from 393537-394088, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, essential protein that interacts with Mpp10p and mediates interactions of Imp4p and Mpp10p with U3 snoRNA"
Sequence
MVRKLKHHEQKLLKKVDFLEWKQDQGHRDTQVMRTYHIQNREDYHKYNRICGDIRRLANK
LSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKM
AETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNSKIKKTLLRYRNQIDDF
DFS
Download sequence
Identical sequences A6ZT56 B3LSR2 B5VK78 C7GJZ0 C8Z9U5 E7KPJ2 E7LVH6 E7NIP2 E7Q4T9 E7QFR2 G2WFM1 H0GHI6 P32899
YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W YHR148W 4932.YHR148W YHR148W SCRT_04861 YHR148W tr|A6ZT56|A6ZT56_YEAS7 YHR148W YHR148W YHR148W YHR148W YHR148w___KOG4655 YHR148W YHR148W YHR148W

Jump to [ Top of page · Domain architecture · Domain assignment details ]