SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR175W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR175W   Protein: S000001218
Sequence length 189
Comment CTR2 SGDID:S000001218, Chr VIII from 452872-453441, Verified ORF, "Putative low-affinity copper transporter of the vacuolar membrane; mutation confers resistance to toxic copper concentrations, while overexpression confers resistance to copper starvation"
Sequence
MDDKKTWSTVTLRTFNQLVTSSLIGYSKKMDSMNHKMEGNAGHDHSDMHMGDGDDTCSMN
MLFSWSYKNTCVVFEWWHIKTLPGLILSCLAIFGLAYLYEYLKYCVHKRQLSQRVLLPNR
SLTKINQADKVSNSILYGLQVGFSFMLMLVFMTYNGWLMLAVVCGAIWGNYSWCTSYSPE
IDDSSLACH
Download sequence
Identical sequences B3LST7 B5VKA2 C8Z9X1 E7KPL3 H0GHK7 N1P9H7 P38865 W7PJZ3 W7QY46
YHR175W YHR175W 4932.YHR175W YHR175W YHR175W SCRT_04887 YHR175W YHR175W YHR175W YHR175W YHR175W YHR175W YHR175W YHR175W YHR175W YHR175W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]