SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR180C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR180C-B   Protein: S000028554
Sequence length 34
Comment YHR180C-B SGDID:S000028554, Chr VIII from 467062-466958, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the dubious ORF YHR180W-A"
Sequence
MPPARIELATFALQVQRSTTKLRRLKIQLCCISK
Download sequence
Identical sequences P0C5N5
YHR180C-B 4932.YHR180C-B YHR180C-B YHR180C-B YHR180C-B YHR180C-B YHR180C-B YHR180C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]