SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR180C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR180C-B   Protein: S000028554
Sequence length 34
Comment YHR180C-B SGDID:S000028554, Chr VIII from 467062-466958, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the dubious ORF YHR180W-A"
Sequence
MPPARIELATFALQVQRSTTKLRRLKIQLCCISK
Download sequence
Identical sequences P0C5N5
YHR180C-B YHR180C-B YHR180C-B YHR180C-B 4932.YHR180C-B YHR180C-B YHR180C-B YHR180C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]