SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR180W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR180W-A   Protein: S000028555
Sequence length 60
Comment YHR180W-A SGDID:S000028555, Chr VIII from 466932-467114, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps dubious ORF YHR180C-B and long terminal repeat YHRCsigma3"
Sequence
MTYCHTDVSYFEIQHSCIFSLLSLVVERCTCNAKVASSILAGGIIPVLFFFPLFLFLYHL
Download sequence
Identical sequences P0C5N8
YHR180W-A YHR180W-A 4932.YHR180W-A YHR180W-A YHR180W-A YHR180W-A YHR180W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]