SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR180W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR180W-A   Protein: S000028555
Sequence length 60
Comment YHR180W-A SGDID:S000028555, Chr VIII from 466932-467114, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps dubious ORF YHR180C-B and long terminal repeat YHRCsigma3"
Sequence
MTYCHTDVSYFEIQHSCIFSLLSLVVERCTCNAKVASSILAGGIIPVLFFFPLFLFLYHL
Download sequence
Identical sequences P0C5N8
YHR180W-A YHR180W-A 4932.YHR180W-A YHR180W-A YHR180W-A YHR180W-A YHR180W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]