SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR186C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR186C
Domain Number 1 Region: 1201-1548
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.6e-29
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 2 Region: 541-644,706-838,879-994
Classification Level Classification E-value
Superfamily ARM repeat 3.84e-28
Family PBS lyase HEAT-like repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
protein targeting 1.508 26.95
protein localization to organelle 1.46 26.95
protein import into nucleus 2.015 26.95
lipid biosynthetic process 1.45 24.21
cell division 1.424 19.32
mitotic cell cycle process 1.491 19.06
mitotic nuclear division 2.144 19.06
epithelial cell development 1.399 18.05
blood vessel morphogenesis 1.414 18.05
endothelium development 2.034 18.05
Cellular Component IC (bits) H-Score
nucleolus 1.641 36.88
membrane coat 2.107 29.29
transferase complex 1.423 23.98
trans-Golgi network 1.793 19.11
cytosol 1.301 13.3
side of membrane 1.701 12.74
transcription factor complex 1.912 12.5
extrinsic component of plasma membrane 1.992 12.34
chromosomal part 1.477 11.08
endocytic vesicle 1.433 10.75

Protein sequence

External link(s) Locus: YHR186C   Protein: S000001229
Sequence length 1557
Comment KOG1 SGDID:S000001229, Chr VIII from 480672-475999, reverse complement, Verified ORF, "Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors"
Sequence
MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQ
RDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQD
SKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHG
VPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRI
KDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF
LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTA
ITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHP
MWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQ
TQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELW
LKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSA
MINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVL
ASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNT
GAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQ
NQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPL
INDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQ
GSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSK
AHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQS
LGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPL
NSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWS
KKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDL
KLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQI
RGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVY
DRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES
FVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVT
STLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF
Download sequence
Identical sequences A6ZT92 N1P4W1 P38873
YHR186C 4932.YHR186C YHR186C YHR186C YHR186C YHR186C YHR186C YHR186C tr|A6ZT92|A6ZT92_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]