SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YHR186C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR186C
Domain Number 1 Region: 1201-1548
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.6e-29
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 2 Region: 541-644,706-838,879-994
Classification Level Classification E-value
Superfamily ARM repeat 3.84e-28
Family PBS lyase HEAT-like repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleolus 1.651 36.87
membrane coat 2.106 28.56
trans-Golgi network 1.797 19.2
cilium 1.61 16.6
cytosol 1.305 13.34
mitochondrial envelope 1.57 11.82
mitochondrial membrane part 1.917 11.82
extrinsic to plasma membrane 1.991 10.49
adherens junction 1.365 9.56
cell-cell adherens junction 1.817 9.56
Biological Process IC (bits) H-Score
protein targeting to nucleus 2.015 26.98
cytoplasmic transport 1.347 26.87
nuclear import 2.003 26.87
protein localization to organelle 1.462 24.65
protein localization to nucleus 1.952 24.65
lipid biosynthetic process 1.447 23.4
protein import 1.941 22.34
cilium morphogenesis 1.418 21.14
cilium organization 2.112 20.87
alpha-amino acid metabolic process 1.38 20.18

Protein sequence

External link(s) Locus: YHR186C   Protein: S000001229
Sequence length 1557
Comment KOG1 SGDID:S000001229, Chr VIII from 480672-475999, reverse complement, Verified ORF, "Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors"
Sequence
MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQ
RDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQD
SKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHG
VPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRI
KDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF
LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTA
ITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHP
MWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQ
TQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELW
LKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSA
MINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVL
ASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNT
GAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQ
NQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPL
INDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQ
GSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSK
AHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQS
LGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPL
NSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWS
KKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDL
KLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQI
RGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVY
DRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES
FVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVT
STLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF
Download sequence
Identical sequences A6ZT92 N1P4W1 P38873
YHR186C YHR186C YHR186C 4932.YHR186C YHR186C YHR186C YHR186C tr|A6ZT92|A6ZT92_YEAS7 YHR186C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]