SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR186C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR186C
Domain Number 1 Region: 1201-1548
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.6e-29
Family WD40-repeat 0.0092
Further Details:      
 
Domain Number 2 Region: 541-644,706-838,879-994
Classification Level Classification E-value
Superfamily ARM repeat 3.84e-28
Family PBS lyase HEAT-like repeat 0.066
Further Details:      
 

Protein sequence

External link(s) Locus: YHR186C   Protein: S000001229
Sequence length 1557
Comment KOG1 SGDID:S000001229, Chr VIII from 480672-475999, reverse complement, Verified ORF, "Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors"
Sequence
MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTNGNPIPEEDKQ
RDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDVMKTHPCARVEAWVDPLNFQD
SKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHG
VPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRI
KDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF
LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTA
ITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHP
MWKSWDLAMDEVLTKIVIDLKNAPPATALESQMILQQQETLQNGGSSKSNAQDTKAGSIQ
TQSRFAVANLSTMSLVNNPALQSRKSISLQSSQQQLQQQQQQQQQFTGFFEQNLTAFELW
LKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKL
LQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDWGVNGMSATNGSA
MINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHNNLPFYHSNDTTDEQKAMAVFVL
ASFVRNFPLGQKNCFSLELVNKLCFYIDNSEIPLLRQWCVILLGLLFADNPLNRFVCMNT
GAVEILLKSLKDPVPEVRTASIFALKHFISGFQDAEVILRLQQEFEEQYQQLHSQLQHLQ
NQSHLQQQQSQQQQQHLEQQQMKIEKQIRHCQVMQNQLEVIDLRKLKRQEIGNLISILPL
INDGSSLVRKELVVYFSHIVSRYSNFFIVVVFNDLLEEIKLLEKSDINTRNTSDKYSVSQ
GSIFYTVWKSLLILAEDPFLENKELSKQVIDYILLELSAHKELGGPFAVMEKFLLKRSSK
AHQTGKFGFNSSQVQFVKSSLRSFSPNERVDNNAFKKEQQQHDPKISHPMRTSLAKLFQS
LGFSESNSDSDTQSSNTSMKSHTSKKGPSGLYLLNGNNNIYPTAETPRFRKHTEPLQLPL
NSSFLDYSREYFQEPQMKKQEADEPGSVEYNARLWRRNRNETIIQETQGEKKLSIYGNWS
KKLISLNNKSQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDL
KLINEDDSALLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQI
RGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVY
DRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVES
FVDQNVTSQYGSQQKPTTMTCMQVHEHAPIIATGTKQIKIWTTSGDLLNSFKNSHNNGVT
STLAATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDSIVNIYKCEDERIDYF
Download sequence
Identical sequences A6ZT92 P38873
YHR186C 4932.YHR186C YHR186C YHR186C YHR186C tr|A6ZT92|A6ZT92_YEAS7 YHR186C YHR186C YHR186C

Jump to [ Top of page · Domain architecture · Domain assignment details ]