SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR190W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR190W
Domain Number 1 Region: 41-376
Classification Level Classification E-value
Superfamily Terpenoid synthases 2.01e-82
Family Squalene synthase 7.87e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YHR190W   Protein: S000001233
Sequence length 444
Comment ERG9 SGDID:S000001233, Chr VIII from 484845-486179, Verified ORF, "Farnesyl-diphosphate farnesyl transferase (squalene synthase), joins two farnesyl pyrophosphate moieties to form squalene in the sterol biosynthesis pathway"
Sequence
MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIREL
HPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDR
AVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCH
YVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPK
EIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQ
VMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQD
PNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYK
FNMVLSIILSVLLGFYYIYTLHRA
Download sequence
Identical sequences P29704
YHR190W YHR190W 4932.YHR190W YHR190W YHR190W YHR190W

Jump to [ Top of page · Domain architecture · Domain assignment details ]