SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR214C-C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR214C-C
Domain Number - Region: 260-340
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0706
Family HBL-like 0.054
Further Details:      
 

Protein sequence

External link(s) Locus: YHR214C-C   Protein: S000007421
Sequence length 478
Comment YHR214C-C SGDID:S000007421, Chr VIII from 549346-547910, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENLHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIP
TVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSD
TQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYK
FLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNYRRNPSDEKNDSRSYTNTTKPKV
IARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKSTTEPIQLNNKHDLHLRPETY
Download sequence
Identical sequences P0C2I4
YHR214C-C 4932.YHR214C-C YHR214C-C YHR214C-C

Jump to [ Top of page · Domain architecture · Domain assignment details ]