SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR214C-D from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR214C-D   Protein: S000028653
Sequence length 97
Comment YHR214C-D SGDID:S000028653, Chr VIII from 550941-550648, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MEDHTLVAIVVFFGNGEPFHVSLSVEMVFVLLLSSTRIHEVVVLICYKLQHATWSWGNMS
KNFSLKPDISLSFLLDIISINDICIYGCIALTVVFIL
Download sequence
Identical sequences C7GJR3 C8Z7M7 P0CX92 P0CX93 W7PIW6
YAR069C YHR214C-D 4932.YAR069C 4932.YHR214C-D YAR069C YHR214C-D YAR069C YHR214C-D YHR214C-D YAR069C YHR214C-D YHR214C-D YHR214C-D YAR069C YHR214C-D YAR069C YHR214C-D YAR069C YHR214C-D

Jump to [ Top of page · Domain architecture · Domain assignment details ]