SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR214C-D from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR214C-D   Protein: S000028653
Sequence length 97
Comment YHR214C-D SGDID:S000028653, Chr VIII from 550941-550648, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MEDHTLVAIVVFFGNGEPFHVSLSVEMVFVLLLSSTRIHEVVVLICYKLQHATWSWGNMS
KNFSLKPDISLSFLLDIISINDICIYGCIALTVVFIL
Download sequence
Identical sequences C7GJR3 C8Z7M7 P0CX92 P0CX93 W7PIW6
YAR069C YHR214C-D YAR069C YHR214C-D 4932.YAR069C 4932.YHR214C-D YAR069C YHR214C-D YHR214C-D YAR069C YHR214C-D YAR069C YHR214C-D YAR069C YHR214C-D YHR214C-D YAR069C YHR214C-D YHR214C-D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]