SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR214C-E from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR214C-E
Domain Number - Region: 45-77
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0114
Family NOB1 zinc finger-like 0.014
Further Details:      
 

Protein sequence

External link(s) Locus: YHR214C-E   Protein: S000028654
Sequence length 99
Comment YHR214C-E SGDID:S000028654, Chr VIII from 551499-551200, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFFCNLCGHSMVR
TCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV
Download sequence
Identical sequences B3LUG0 C7GJR2 C8Z7M6 Q8TGK0 W7PR53
YHR214C-E YAR070C YHR214C-E YAR070C YHR214C-E YHR214C-E YHR214C-E YHR214C-E YAR070C YHR214C-E YHR214C-E YAR070C YHR214C-E YHR214C-E 4932.YHR214C-E YHR214C-E YHR214C-E SCRT_05496 YAR070C YHR214C-E YAR070C YHR214C-E YHR214C-E

Jump to [ Top of page · Domain architecture · Domain assignment details ]