SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR214C-E from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR214C-E
Domain Number - Region: 45-77
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0114
Family NOB1 zinc finger-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR214C-E   Protein: S000028654
Sequence length 99
Comment YHR214C-E SGDID:S000028654, Chr VIII from 551499-551200, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFFCNLCGHSMVR
TCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV
Download sequence
Identical sequences B3LUG0 C7GJR2 C8Z7M6 Q8TGK0 W7PR53
YAR070C YHR214C-E YHR214C-E YAR070C YHR214C-E YHR214C-E YHR214C-E YHR214C-E YAR070C YHR214C-E YHR214C-E 4932.YHR214C-E SCRT_05496 YAR070C YHR214C-E YHR214C-E YHR214C-E YHR214C-E YAR070C YHR214C-E YHR214C-E YAR070C YHR214C-E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]