SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHR218W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR218W-A
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000152
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR218W-A   Protein: S000028786
Sequence length 105
Comment YHR218W-A SGDID:S000028786, Chr VIII from 559932-560249, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARN
RKGELPPIKEGCITEQVREFYGLESKKGKKGPACWMLWLQDRPVC
Download sequence
Identical sequences A0A023PXF5 Q3E7Y4
4932.YBL112C 4932.YHR218W-A YBL112C YHR218W-A YBL112C YHR218W-A YBL112C YHR218W-A NP_009438.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]