SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR218W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR218W-A
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-07
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 

Protein sequence

External link(s) Locus: YHR218W-A   Protein: S000028786
Sequence length 105
Comment YHR218W-A SGDID:S000028786, Chr VIII from 559932-560249, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARN
RKGELPPIKEGCITEQVREFYGLESKKGKKGPACWMLWLQDRPVC
Download sequence
Identical sequences Q3E7Y4
YBL112C YHR218W-A 4932.YBL112C 4932.YHR218W-A YBL112C YHR218W-A YBL112C YHR218W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]