SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR218W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR218W-A
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-07
Family Tandem AAA-ATPase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YHR218W-A   Protein: S000028786
Sequence length 105
Comment YHR218W-A SGDID:S000028786, Chr VIII from 559932-560249, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARN
RKGELPPIKEGCITEQVREFYGLESKKGKKGPACWMLWLQDRPVC
Download sequence
Identical sequences Q3E7Y4
YBL112C YHR218W-A 4932.YBL112C 4932.YHR218W-A YBL112C YHR218W-A YBL112C YHR218W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]