SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR219C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHR219C-A   Protein: S000028655
Sequence length 160
Comment YHR219C-A SGDID:S000028655, Chr VIII from 561681-561199, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALFFVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKKFQIPYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences A6ZRE8 P0CL34 P0CL35 P0CL36
YHR219C-A YML133W-B YNL339W-B 4932.YHR219C-A 4932.YML133W-B 4932.YNL339W-B YHR219C-A YML133W-B YNL339W-B YHR219C-A YML133W-B YNL339W-B YBL113W-A YEL077W-A YHR219C-A YLL066W-A YLL067W-A tr|A6ZRE8|A6ZRE8_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]