SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHR219C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR219C-A   Protein: S000028655
Sequence length 160
Comment YHR219C-A SGDID:S000028655, Chr VIII from 561681-561199, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALFFVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKKFQIPYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences A6ZRE8 P0CL34 P0CL35 P0CL36
YHR219C-A YML133W-B YNL339W-B YHR219C-A YML133W-B YNL339W-B 4932.YHR219C-A 4932.YML133W-B 4932.YNL339W-B YHR219C-A YML133W-B YNL339W-B tr|A6ZRE8|A6ZRE8_YEAS7 YBL113W-A YEL077W-A YHR219C-A YLL066W-A YLL067W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]