SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL009W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL009W
Domain Number 1 Region: 92-378,415-691
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.22e-88
Family Acetyl-CoA synthetase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.955 17.59
basolateral plasma membrane 1.922 6.92
intrinsic to organelle membrane 2.082 5.87
basal part of cell 2.168 5.08
lipid particle 1.519 4.27
Biological Process IC (bits) H-Score
fatty acid metabolic process 1.625 47.7
coenzyme biosynthetic process 1.926 38.58
response to cytokine stimulus 1.502 33.49
cytokine-mediated signaling pathway 1.952 33.49
thioester metabolic process 2.082 32.31
amide biosynthetic process 1.508 26.39
lipid transport 1.878 20.63
peptide metabolic process 1.563 18.06
pigmentation 2.034 16.91
cuticle development 2.009 16.91

Protein sequence

External link(s) Locus: YIL009W   Protein: S000001271
Sequence length 694
Comment FAA3 SGDID:S000001271, Chr IX from 339341-341425, Verified ORF, "Long chain fatty acyl-CoA synthetase, has a preference for C16 and C18 fatty acids; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery"
Sequence
MSEQHSVAVGKAANEHETAPRRNVRVKKRPLIRPLNSSASTLYEFALECFNKGGKRDGMA
WRDVIEIHETKKTIVRKVDGKDKSIEKTWLYYEMSPYKMMTYQELIWVMHDMGRGLAKIG
IKPNGEHKFHIFASTSHKWMKIFLGCISQGIPVVTAYDTLGESGLIHSMVETESAAIFTD
NQLLAKMIVPLQSAKDIKFLIHNEPIDPNDRRQNGKLYKAAKDAINKIREVRPDIKIYSF
EEVVKIGKKSKDEVKLHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFG
WIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVKTLTNTSTRNCKGDLVEFKPTI
MIGVAAVWETVRKAILEKISDLTPVLQKIFWSAYSMKEKSVPCTGFLSRMVFKKVRQATG
GHLKYIMNGGSAISIDAQKFFSIVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGS
VTAKLVDVKDLGYYAKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTP
KGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSNSYVKNICVYADESRVKPVGIVVPNPG
PLSKFAVKLRIMKKGEDIENYIHDKALRNAVFKEMIATAKSQGLVGIELLCGIVFFDEEW
TPENGFVTSAQKLKRREILAAVKSEVERVYKENS
Download sequence
Identical sequences N1P1Q5 P39002
YIL009W 4932.YIL009W YIL009W YIL009W YIL009W YIL009W YIL009W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]