SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL009W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL009W
Domain Number 1 Region: 92-378,415-691
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.22e-88
Family Acetyl-CoA synthetase-like 0.00018
Further Details:      
 

Protein sequence

External link(s) Locus: YIL009W   Protein: S000001271
Sequence length 694
Comment FAA3 SGDID:S000001271, Chr IX from 339341-341425, Verified ORF, "Long chain fatty acyl-CoA synthetase, has a preference for C16 and C18 fatty acids; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery"
Sequence
MSEQHSVAVGKAANEHETAPRRNVRVKKRPLIRPLNSSASTLYEFALECFNKGGKRDGMA
WRDVIEIHETKKTIVRKVDGKDKSIEKTWLYYEMSPYKMMTYQELIWVMHDMGRGLAKIG
IKPNGEHKFHIFASTSHKWMKIFLGCISQGIPVVTAYDTLGESGLIHSMVETESAAIFTD
NQLLAKMIVPLQSAKDIKFLIHNEPIDPNDRRQNGKLYKAAKDAINKIREVRPDIKIYSF
EEVVKIGKKSKDEVKLHPPEPKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFG
WIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVKTLTNTSTRNCKGDLVEFKPTI
MIGVAAVWETVRKAILEKISDLTPVLQKIFWSAYSMKEKSVPCTGFLSRMVFKKVRQATG
GHLKYIMNGGSAISIDAQKFFSIVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGS
VTAKLVDVKDLGYYAKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTP
KGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSNSYVKNICVYADESRVKPVGIVVPNPG
PLSKFAVKLRIMKKGEDIENYIHDKALRNAVFKEMIATAKSQGLVGIELLCGIVFFDEEW
TPENGFVTSAQKLKRREILAAVKSEVERVYKENS
Download sequence
Identical sequences N1P1Q5 P39002
YIL009W 4932.YIL009W YIL009W YIL009W YIL009W YIL009W YIL009W

Jump to [ Top of page · Domain architecture · Domain assignment details ]