SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL020C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL020C
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.1e-34
Family Histidine biosynthesis enzymes 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plastid 1.6 7.51
cytosol 1.301 3.34

Protein sequence

External link(s) Locus: YIL020C   Protein: S000001282
Sequence length 261
Comment HIS6 SGDID:S000001282, Chr IX from 314818-314033, reverse complement, Verified ORF, "Phosphoribosyl-5-amino-1-phosphoribosyl-4-imidazolecarboxiamide isomerase, catalyzes the fourth step in histidine biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts"
Sequence
MTKFIGCIDLHNGEVKQIVGGTLTSKKEDVPKTNFVSQHPSSYYAKLYKDRDVQGCHVIK
LGPNNDDAAREALQESPQFLQVGGGINDTNCLEWLKWASKVIVTSWLFTKEGHFQLKRLE
RLTELCGKDRIVVDLSCRKTQDGRWIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAA
DVEGLCGGIDELLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHGKVDLTFGSSL
DIFGGNLVKFEDCCRWNEKQG
Download sequence
Identical sequences B5VKS1 C7GPW8 C8ZAN0 E7KDW1 E7KPX9 E7LVS1 E7QG69 H0GI06 P40545 W7PFA0 W7RA89
YIL020C YIL020C YIL020C YIL020c YT511 YIL020C YIL020C YIL020C YIL020C 4932.YIL020C YIL020C YIL020C YIL020C YIL020C YIL020C YIL020C YIL020C YIL020C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]