SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL021C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL021C-A
Domain Number - Region: 9-47
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0806
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL021C-A   Protein: S000028656
Sequence length 89
Comment YIL021C-A SGDID:S000028656, Chr IX from 313466-313197, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps verified gene RPB3/YIL021W; identified by gene-trapping, expression analysis, and genome-wide homology searching"
Sequence
MFELIPRIILELYGCCWTPLGVLFGYTLFRNACQFQFLTFSQFTNKNTVTFFILYNRMPN
ITAHEIRHNYQVLAVDVCSTFAFAERLQC
Download sequence
Identical sequences C8ZAM8 Q8TGN4
YIL021C-A YIL021C-A 4932.YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]