SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL021C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL021C-A
Domain Number - Region: 9-47
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0806
Family Rhodopsin-like 0.03
Further Details:      
 

Protein sequence

External link(s) Locus: YIL021C-A   Protein: S000028656
Sequence length 89
Comment YIL021C-A SGDID:S000028656, Chr IX from 313466-313197, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps verified gene RPB3/YIL021W; identified by gene-trapping, expression analysis, and genome-wide homology searching"
Sequence
MFELIPRIILELYGCCWTPLGVLFGYTLFRNACQFQFLTFSQFTNKNTVTFFILYNRMPN
ITAHEIRHNYQVLAVDVCSTFAFAERLQC
Download sequence
Identical sequences C8ZAM8 Q8TGN4
YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A 4932.YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A YIL021C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]