SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL021W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL021W
Domain Number 1 Region: 42-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.85e-47
Family Insert subdomain of RNA polymerase alpha subunit 0.000000147
Further Details:      
 
Domain Number 2 Region: 172-266
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.16e-20
Family RNA polymerase alpha subunit dimerisation domain 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
RNA polymerase complex 1.998 86.15
transferase complex 1.423 36.47
nucleoplasm part 1.496 8.37
plastid 1.6 4.99
nucleolus 1.641 3.65
Molecular Function IC (bits) H-Score
nucleotidyltransferase activity 1.653 40.24
Biological Process IC (bits) H-Score
RNA biosynthetic process 1.516 24.62
macropinocytosis 2.207 4.51

Protein sequence

External link(s) Locus: YIL021W   Protein: S000001283
Sequence length 318
Comment RPB3 SGDID:S000001283, Chr IX from 312903-313859, Verified ORF, "RNA polymerase II third largest subunit B44, part of central core; similar to prokaryotic alpha subunit"
Sequence
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW
Download sequence
Identical sequences A6ZVP6 B3LTM9 B5VKS0 C7GPW9 C8ZAM7 E7KDW0 E7QG68 G2WGC3 H0GI05 N1P1P4 P16370 W7PR08
YIL021W YIL021W YIL021W YIL021W tr|A6ZVP6|A6ZVP6_YEAS7 YIL021W YIL021W YIL021W YIL021W 4932.YIL021W YIL021W YIL021W SCRT_05201 YIL021W YIL021W 1twfC YIL021W YIL021W YIL021W YIL021W 1i3q.C 1i50.C 1i6h.C 1k83.C 1nik.C 1nt9.C 1pqv.C 1r5u.C 1r9r.C 1r9s.C 1r9t.C 1sfo.C 1twa.C 1twc.C 1twf.C 1twg.C 1twh.C 1wcm.C 1y1v.C 1y1w.C 1y1y.C 1y77.C 2b63.C 2b8k.C 2e2h.C 2e2i.C 2e2j.C 2ja5.C 2ja6.C 2ja7.C 2ja7.O 2ja8.C 2nvq.C 2nvs.C 2nvt.C 2nvx.C 2nvy.C 2nvz.C 2r7z.C 2r92.C 2r93.C 2vum.C 2yu9.C 3cqz.C 3fki.C 3gtg.C 3gtj.C 3gtk.C 3gtl.C 3gtm.C 3gto.C 3gtp.C 3gtq.C 3h3v.D 3hou.C 3hou.O 3hov.C 3k1f.C 3k7a.C 3m3y.C 3m4o.C 3po2.C 3po3.C 3qt1.C 3rzd.C 3rzo.C 3s14.C 3s15.C 3s16.C 3s17.C 3s1m.C 3s1n.C 3s1q.C 3s1r.C 3s2d.C 3s2h.C 4a3b.C 4a3c.C 4a3d.C 4a3e.C 4a3f.C 4a3g.C 4a3i.C 4a3j.C 4a3k.C 4a3l.C 4a3m.C 4a93.C 4bbr.C 4bbs.C 4bxx.C 4bxz.C 4by1.C 4by7.C YIL021W YIL021W YIL021W YIL021W YIL021W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]