SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL030W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL030W-A   Protein: S000028789
Sequence length 112
Comment YIL030W-A SGDID:S000028789, Chr IX from 295564-295902, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YIL031W."
Sequence
MMWHLVVQLGVFQEPARQARDQMHNFSLIMEMKITSLKILFGMRAEIILYSWKMKTLEST
RTHSFIFFILFLFIFIFLTFSHNNSNSNKITSNIHTHINRHIFYFVLSYSEW
Download sequence
Identical sequences C8ZAL6 W7PSI5
YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A 4932.YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]