SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL030W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIL030W-A   Protein: S000028789
Sequence length 112
Comment YIL030W-A SGDID:S000028789, Chr IX from 295564-295902, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YIL031W."
Sequence
MMWHLVVQLGVFQEPARQARDQMHNFSLIMEMKITSLKILFGMRAEIILYSWKMKTLEST
RTHSFIFFILFLFIFIFLTFSHNNSNSNKITSNIHTHINRHIFYFVLSYSEW
Download sequence
Identical sequences C8ZAL6
YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A 4932.YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A YIL030W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]