SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL047C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIL047C-A   Protein: S000028790
Sequence length 122
Comment YIL047C-A SGDID:S000028790, Chr IX from 265466-265098, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNMLPMFTYSGLPVTLLCLIQLRRSVMILWIVVIWVQKPFHHLTTYLSRLHMTIILTVLP
NLCPLTVGLSEEGPPCLRTFRDPFLGHMQLISKDQLSIPWMIGLPKQIVKVKWKVLCDLG
WT
Download sequence
Identical sequences C8ZAJ9 W7PSH6
YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A 4932.YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A YIL047C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]