SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL071W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL071W-A   Protein: S000028793
Sequence length 158
Comment YIL071W-A SGDID:S000028793, Chr IX from 228547-229023, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNNKVTLLPPRVFFCLSWSVMVNIDRRKSDRSVNLDDQHSNKPPSESLISLLSLTSSMSI
SSLLSLLIIVAVLFPPLYISGLPWIMSFKSVFSFFSLSITSFIMVPFLLISLTILCKIEL
SSKCITSPSISKFNCPDIINFVNSSLISSKSIPSVDDK
Download sequence
Identical sequences W7PIN3
YIL071W-A YIL071W-A 4932.YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]