SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL071W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIL071W-A   Protein: S000028793
Sequence length 158
Comment YIL071W-A SGDID:S000028793, Chr IX from 228547-229023, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNNKVTLLPPRVFFCLSWSVMVNIDRRKSDRSVNLDDQHSNKPPSESLISLLSLTSSMSI
SSLLSLLIIVAVLFPPLYISGLPWIMSFKSVFSFFSLSITSFIMVPFLLISLTILCKIEL
SSKCITSPSISKFNCPDIINFVNSSLISSKSIPSVDDK
Download sequence
Identical sequences YIL071W-A YIL071W-A 4932.YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A YIL071W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]