SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL080W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL080W
Domain Number 1 Region: 609-1020
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-141
Family Reverse transcriptase 6.68e-05
Further Details:      
 
Domain Number 2 Region: 1187-1344
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.09e-38
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 2.7e-07
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 4.81e-06
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Protein sequence

External link(s) Locus: YIL080W   Protein: S000001342
Sequence length 1569
Comment YIL080W SGDID:S000001342, Chr IX from 205632-206481,206483-210354, pseudogene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARRRVLTDLELESKDQQTL
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLQITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGN
PRNTKLSLAPTILEATDPKSAGNRGDSRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQ
FPIPEEASILEEDGKYSNVVSTIQSVEPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPP
RPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSS
PVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQI
PMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFS
ESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRD
FPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQWTEKQDKAIEKLKAALC
NSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGE
LELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEY
LAGPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPE
DMSAFRSYQKKLELSETFRKNYSLEDEMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFG
VTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISM
DFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTIT
SDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNIQNWH
VYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALT
IQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVV
KKINDNAYELDLNSHKKKHRVINVQFLKSLYTVQTRTQRINQSAPLRELREHTKLLHSEI
LHTKLTYVTCKTTQHFQNTQKLNFAKFPKEHEDQYPTLDNSTKHKTTLRERKMLYLKMRY
VSMTIRHPE
Download sequence
Identical sequences YIL080W

Jump to [ Top of page · Domain architecture · Domain assignment details ]