SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL080W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL080W
Domain Number 1 Region: 609-1020
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-141
Family Reverse transcriptase 0.0000668
Further Details:      
 
Domain Number 2 Region: 1187-1344
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.09e-38
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 0.00000027
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000481
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
replication fork 2.208 26.38
cytoplasmic ribonucleoprotein granule 1.98 22.55
endocytic vesicle 1.433 15.58
ribonucleoprotein complex 1.414 15.53
small nuclear ribonucleoprotein complex 2.005 13.11
DNA repair complex 2.141 11.46
exosome (RNase complex) 2.218 10.38
external encapsulating structure 1.632 9.54
mitochondrial matrix 1.714 9.49
secretory granule 1.818 6.47

Protein sequence

External link(s) Locus: YIL080W   Protein: S000001342
Sequence length 1569
Comment YIL080W SGDID:S000001342, Chr IX from 205632-206481,206483-210354, pseudogene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARRRVLTDLELESKDQQTL
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLQITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGN
PRNTKLSLAPTILEATDPKSAGNRGDSRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQ
FPIPEEASILEEDGKYSNVVSTIQSVEPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPP
RPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSS
PVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQI
PMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFS
ESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRD
FPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQWTEKQDKAIEKLKAALC
NSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGE
LELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEY
LAGPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPE
DMSAFRSYQKKLELSETFRKNYSLEDEMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFG
VTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISM
DFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTIT
SDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNIQNWH
VYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALT
IQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVV
KKINDNAYELDLNSHKKKHRVINVQFLKSLYTVQTRTQRINQSAPLRELREHTKLLHSEI
LHTKLTYVTCKTTQHFQNTQKLNFAKFPKEHEDQYPTLDNSTKHKTTLRERKMLYLKMRY
VSMTIRHPE
Download sequence
Identical sequences YIL080W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]