SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL082W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL082W
Domain Number 1 Region: 248-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 5.86e-06
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Protein sequence

External link(s) Locus: YIL082W   Protein: S000001344
Sequence length 290
Comment YIL082W SGDID:S000001344, Chr IX from 205632-206504, Dubious ORF, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARKASSNRS
Download sequence
Identical sequences Q99219
YGR109W-A YIL082W YIL082W 4932.YIL082W YIL082W YIL082W

Jump to [ Top of page · Domain architecture · Domain assignment details ]