SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YIL082W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL082W
Domain Number 1 Region: 248-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000586
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.418 28.79
ribonucleoprotein complex 1.418 10.23
ribonucleoprotein granule 1.999 9.56
nuclear body 1.902 6.61
spliceosomal complex 2.025 4.98
Molecular Function IC (bits) H-Score
kinase binding 1.678 22.86
DNA polymerase activity 2.238 9.99
nucleotidyltransferase activity 1.651 9.07
nuclease activity 1.721 5.99
ribonuclease activity 1.943 5.99
RNA binding 1.36 5.85

Protein sequence

External link(s) Locus: YIL082W   Protein: S000001344
Sequence length 290
Comment YIL082W SGDID:S000001344, Chr IX from 205632-206504, Dubious ORF, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARKASSNRS
Download sequence
Identical sequences Q99219
4932.YIL082W YIL082W YIL082W YGR109W-A YIL082W YIL082W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]