SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL082W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL082W-A
Domain Number 1 Region: 609-1020
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2e-141
Family Reverse transcriptase 6.68e-05
Further Details:      
 
Domain Number 2 Region: 1187-1344
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.02e-38
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 2.7e-07
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 3.77e-06
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Most Informative Gene Ontologies

Protein sequence

External link(s) Locus: YIL082W-A   Protein: S000003537
Sequence length 1498
Comment YIL082W-A SGDID:S000003537, Chr IX from 205632-206482,206484-210129, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARKRVLTDLELESKDQQTL
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLQITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGN
PRNTKLSLAPTILEATDPKSAGNRGDSRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQ
FPIPEEASILEEDGKYSNVVSTIQSVEPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPP
RPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSS
PVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQI
PMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFS
ESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRD
FPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQWTEKQDKAIEKLKAALC
NSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGE
LELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEY
LAGPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPE
DMSAFRSYQKKLELSETFRKNYSLEDEMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFG
VTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISM
DFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTIT
SDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNIQNWH
VYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALT
IQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVV
KKINDNAYELDLNSHKKKHRVINVQFLKSLYTVQTRTQRINQSAPLRELREHTKLLHS
Download sequence
Identical sequences YIL082W-A YIL082W-A 4932.YIL082W-A YIL082W-A YIL082W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]