SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YIL082W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL082W-A
Domain Number 1 Region: 609-1020
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2e-141
Family Reverse transcriptase 0.0000668
Further Details:      
 
Domain Number 2 Region: 1187-1344
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.02e-38
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 0.00000027
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000377
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
secretory vesicle 1.533 58.96
replication fork 2.242 23.9
protein-DNA complex 2.242 21.56
cytoplasmic ribonucleoprotein granule 1.909 18.42
host cell part 1.975 17.51
transferase complex, transferring phosphorus-containing groups 1.653 16.61
cytoplasmic vesicle part 1.438 16.15
endosome 1.318 16.15
endocytic vesicle 1.493 16.15
late endosome 1.806 15.97
Molecular Function IC (bits) H-Score
DNA polymerase activity 2.117 104.53
nuclease activity 1.592 102.2
endopeptidase activity 1.546 56.75
nucleotidyltransferase activity 1.523 53.75
RNA binding 1.279 29.75
lyase activity 1.42 28.47
protein kinase binding 1.503 24.72
deoxyribonuclease activity 2.245 19.38
endonuclease activity 1.995 19.38
miRNA binding 2.245 9.68

Protein sequence

External link(s) Locus: YIL082W-A   Protein: S000003537
Sequence length 1498
Comment YIL082W-A SGDID:S000003537, Chr IX from 205632-206482,206484-210129, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNRYVHTVRTRRS
YNKPMSNHRNRRNNNASREECIKNRLCFYCKKEGHRLNECRARKRVLTDLELESKDQQTL
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLQITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGN
PRNTKLSLAPTILEATDPKSAGNRGDSRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQ
FPIPEEASILEEDGKYSNVVSTIQSVEPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPP
RPADINNIPVKHDIEIKPGARLPRLQPYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSS
PVVLVPKKDGTFRLCVDYRTLNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQI
PMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFARYMADTFRDLRFVNVYLDDILIFS
ESPEEHWKHLDTVLERLKNENLIVKKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRD
FPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPIQLFICDKSQWTEKQDKAIEKLKAALC
NSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGE
LELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEY
LAGPKNVVADAISRAIYTITPETSRPIDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPE
DMSAFRSYQKKLELSETFRKNYSLEDEMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFG
VTVTLAKISPIYYWPKLQHSIIQYIRTCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISM
DFVTGLPPTSNNLNMILVVVDRFSKRAHFIATRKTLDATQLIDLLFRYIFSYHGFPRTIT
SDRDVRMTADKYQELTKRLGIKSTMSSANHPQTDGQSERTIQTLNRLLRAYVSTNIQNWH
VYLPQIEFVYNSTPTRTLGKSPFEIDLGYLPNTPAIKSDDEVNARSFTAVELAKHLKALT
IQTKEQLEHAQIEMETNNNQRRKPLLLNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVV
KKINDNAYELDLNSHKKKHRVINVQFLKSLYTVQTRTQRINQSAPLRELREHTKLLHS
Download sequence
Identical sequences YIL082W-A YIL082W-A 4932.YIL082W-A YIL082W-A YIL082W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]