SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL100C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIL100C-A   Protein: S000028794
Sequence length 112
Comment YIL100C-A SGDID:S000028794, Chr IX from 177678-177340, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MLRSAPLALGLEPHPLNNSLAFPVFYHIHCYCPSPLLLSLLLHYTVLFSPFGARNHKLYI
YIYIYIYIYIYMCINVCTYMNAGPRGVCSLCVYVCTHFNIYIHTYIYLLFVY
Download sequence
Identical sequences Q03884
YIL100C-A YIL100C-A 4932.YIL100C-A YIL100C-A YIL100C-A YIL100C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]