SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL100C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL100C-A   Protein: S000028794
Sequence length 112
Comment YIL100C-A SGDID:S000028794, Chr IX from 177678-177340, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MLRSAPLALGLEPHPLNNSLAFPVFYHIHCYCPSPLLLSLLLHYTVLFSPFGARNHKLYI
YIYIYIYIYIYMCINVCTYMNAGPRGVCSLCVYVCTHFNIYIHTYIYLLFVY
Download sequence
Identical sequences Q03884
YIL100C-A YIL100C-A YIL100C-A YIL100C-A YIL100C-A 4932.YIL100C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]