SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YIL120W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL120W
Domain Number 1 Region: 57-256,290-370,418-541
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-57
Family LacY-like proton/sugar symporter 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
clathrin-coated vesicle 1.876 13.55
vacuolar part 1.621 12.57
cell projection membrane 1.527 11.06
secretory granule 1.826 9.38
brush border 1.48 8.22
coated vesicle 1.74 8.01
cytoplasmic vesicle membrane 1.917 7.82
transport vesicle 2.067 7.67
sperm part 2.207 6.34
synapse part 1.512 6.26

Protein sequence

External link(s) Locus: YIL120W   Protein: S000001382
Sequence length 563
Comment QDR1 SGDID:S000001382, Chr IX from 134414-136105, Verified ORF, "Multidrug transporter of the major facilitator superfamily, required for resistance to quinidine, ketoconazole, fluconazole, and barban"
Sequence
MTKQQTSVMRNASIAKEEREGSDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPY
SRFSHKQKMLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGV
APSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINS
GIMGDVTTKVERGGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSGICLVF
STLLMPETKRTLVGNGSVTPRSFLNRSLILHVGSVKKTLHLDDPDPETLEPRTSVDFLAP
LKILHIREIDILLSIAGLQFSTWTTHQTALTIVLSKKYNLSVAKIGLCFLPAGISTLTSI
ISAGRYLNWSYRTRKVKYNRWIKEQELQLMEKYKGDKNKVAELIHSNSHYAFNLVEARLH
PAFVTLLLSSIGFTAFGWCISVKTPLAAVLCTSAFASLFSNCILTFSTTLIVDLFPSKAS
TATGCLNLFRCLLSAIFIAALTKMVEKMRYGGVFTFLSAITSSSSLLLFYLLKNGKQLSF
DRIRANDKSAGRSVGKNSEKVST
Download sequence
Identical sequences P40475
2408S YIL120W YIL120W YIL120W 4932.YIL120W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]