SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL120W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL120W
Domain Number 1 Region: 57-256,290-370,418-541
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-57
Family LacY-like proton/sugar symporter 0.036
Further Details:      
 

Protein sequence

External link(s) Locus: YIL120W   Protein: S000001382
Sequence length 563
Comment QDR1 SGDID:S000001382, Chr IX from 134414-136105, Verified ORF, "Multidrug transporter of the major facilitator superfamily, required for resistance to quinidine, ketoconazole, fluconazole, and barban"
Sequence
MTKQQTSVMRNASIAKEEREGSDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPY
SRFSHKQKMLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGV
APSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINS
GIMGDVTTKVERGGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSGICLVF
STLLMPETKRTLVGNGSVTPRSFLNRSLILHVGSVKKTLHLDDPDPETLEPRTSVDFLAP
LKILHIREIDILLSIAGLQFSTWTTHQTALTIVLSKKYNLSVAKIGLCFLPAGISTLTSI
ISAGRYLNWSYRTRKVKYNRWIKEQELQLMEKYKGDKNKVAELIHSNSHYAFNLVEARLH
PAFVTLLLSSIGFTAFGWCISVKTPLAAVLCTSAFASLFSNCILTFSTTLIVDLFPSKAS
TATGCLNLFRCLLSAIFIAALTKMVEKMRYGGVFTFLSAITSSSSLLLFYLLKNGKQLSF
DRIRANDKSAGRSVGKNSEKVST
Download sequence
Identical sequences P40475
YIL120W 4932.YIL120W YIL120W 2408S YIL120W

Jump to [ Top of page · Domain architecture · Domain assignment details ]