SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YIL120W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL120W
Domain Number 1 Region: 57-256,290-370,418-541
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-57
Family LacY-like proton/sugar symporter 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
nucleobase-containing compound transport 2.039 39.45
ion transport 1.47 36.53
transmembrane transport 1.581 31.84
secretion 1.506 22.79
cellular chemical homeostasis 1.499 16.18
inorganic ion homeostasis 1.494 16.18
cation homeostasis 1.508 16.18
vacuole organization 2.183 16.18
response to organic cyclic compound 1.42 12.27
response to drug 1.512 12.02
Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.417 14.48
vacuolar part 1.567 14.15
brush border membrane 1.487 11.03
clathrin-coated vesicle 1.989 10.1
presynapse 1.758 9.56
secretory vesicle 1.539 8.53
exocytic vesicle 2.03 7.81
lytic vacuole 1.553 7.12
intrinsic component of organelle membrane 2.016 6.26
synapse part 1.419 5.81

Protein sequence

External link(s) Locus: YIL120W   Protein: S000001382
Sequence length 563
Comment QDR1 SGDID:S000001382, Chr IX from 134414-136105, Verified ORF, "Multidrug transporter of the major facilitator superfamily, required for resistance to quinidine, ketoconazole, fluconazole, and barban"
Sequence
MTKQQTSVMRNASIAKEEREGSDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPY
SRFSHKQKMLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGV
APSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINS
GIMGDVTTKVERGGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSGICLVF
STLLMPETKRTLVGNGSVTPRSFLNRSLILHVGSVKKTLHLDDPDPETLEPRTSVDFLAP
LKILHIREIDILLSIAGLQFSTWTTHQTALTIVLSKKYNLSVAKIGLCFLPAGISTLTSI
ISAGRYLNWSYRTRKVKYNRWIKEQELQLMEKYKGDKNKVAELIHSNSHYAFNLVEARLH
PAFVTLLLSSIGFTAFGWCISVKTPLAAVLCTSAFASLFSNCILTFSTTLIVDLFPSKAS
TATGCLNLFRCLLSAIFIAALTKMVEKMRYGGVFTFLSAITSSSSLLLFYLLKNGKQLSF
DRIRANDKSAGRSVGKNSEKVST
Download sequence
Identical sequences P40475
4932.YIL120W 2408S YIL120W YIL120W YIL120W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]