SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL136W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL136W
Domain Number - Region: 351-378
Classification Level Classification E-value
Superfamily MIT domain 0.00994
Family MIT domain 0.0088
Further Details:      
 

Protein sequence

External link(s) Locus: YIL136W   Protein: S000001398
Sequence length 393
Comment OM45 SGDID:S000001398, Chr IX from 93619-94800, Verified ORF, "Protein of unknown function, major constituent of the mitochondrial outer membrane; located on the outer (cytosolic) face of the outer membrane"
Sequence
MSSRIIVGSAALAAAITASIMVREQKAKGQRREGNVSAYYNGQEYGSSAPPQLGKLHNIK
QGIKEDALSLKDALLGVSQKAREEAPKVTKRVISPEEDAQTRKQLGQKAKDSSSQSIFNW
GFSEAERRKAIAIGEFDTAKKRFEEAVDRNEKELLSTVMREKKAALDRASIEYERYGRAR
DFNELSDKLDQQERNSNPLKRLLKNNTGDANTEEAAARSVQGWGDTAQEFGREELEEAKR
NASSEPSEAQKRLDELKKIKEKGWFGYNKGEQSEQQIAERVARGLEGWGETAAQLSKDEM
DDLRWNYENSKKQLDKNVSDAMDSLSKAKEDLKQYGSHWWSGWTSKVDNDKQALKDEAQK
KYDEALKKYDEAKNKFKEWNDKGDGKFWSSKKD
Download sequence
Identical sequences A6ZVD9 B3LTY4 G2WG15 P16547
YIL136W 4932.YIL136W YIL136W YIL136W SCRT_05310 YIL136W YIL136W YIL136W tr|A6ZVD9|A6ZVD9_YEAS7 YIL136W YIL136W YIL136W YIL136W

Jump to [ Top of page · Domain architecture · Domain assignment details ]