SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL136W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL136W
Domain Number - Region: 351-378
Classification Level Classification E-value
Superfamily MIT domain 0.00994
Family MIT domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL136W   Protein: S000001398
Sequence length 393
Comment OM45 SGDID:S000001398, Chr IX from 93619-94800, Verified ORF, "Protein of unknown function, major constituent of the mitochondrial outer membrane; located on the outer (cytosolic) face of the outer membrane"
Sequence
MSSRIIVGSAALAAAITASIMVREQKAKGQRREGNVSAYYNGQEYGSSAPPQLGKLHNIK
QGIKEDALSLKDALLGVSQKAREEAPKVTKRVISPEEDAQTRKQLGQKAKDSSSQSIFNW
GFSEAERRKAIAIGEFDTAKKRFEEAVDRNEKELLSTVMREKKAALDRASIEYERYGRAR
DFNELSDKLDQQERNSNPLKRLLKNNTGDANTEEAAARSVQGWGDTAQEFGREELEEAKR
NASSEPSEAQKRLDELKKIKEKGWFGYNKGEQSEQQIAERVARGLEGWGETAAQLSKDEM
DDLRWNYENSKKQLDKNVSDAMDSLSKAKEDLKQYGSHWWSGWTSKVDNDKQALKDEAQK
KYDEALKKYDEAKNKFKEWNDKGDGKFWSSKKD
Download sequence
Identical sequences A6ZVD9 B3LTY4 G2WG15 P16547
YIL136W YIL136W YIL136W YIL136W 4932.YIL136W YIL136W YIL136W tr|A6ZVD9|A6ZVD9_YEAS7 YIL136W YIL136W SCRT_05310 YIL136W YIL136W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]