SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL143C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL143C
Domain Number 1 Region: 314-537
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.33e-38
Family Tandem AAA-ATPase domain 0.0013
Further Details:      
 
Domain Number 2 Region: 474-545,578-764
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.29e-33
Family Tandem AAA-ATPase domain 0.0021
Further Details:      
 

Protein sequence

External link(s) Locus: YIL143C   Protein: S000001405
Sequence length 843
Comment SSL2 SGDID:S000001405, Chr IX from 83041-80510, reverse complement, Verified ORF, "Component of the holoenzyme form of RNA polymerase transcription factor TFIIH, has DNA-dependent ATPase/helicase activity and is required, with Rad3p, for unwinding promoter DNA; involved in DNA repair; homolog of human ERCC3"
Sequence
MTDVEGYQPKSKGKIFPDMGESFFSSDEDSPATDAEIDENYDDNRETSEGRGERDTGAMV
TGLKKPRKKTKSSRHTAADSSMNQMDAKDKALLQDTNSDIPADFVPDSVSGMFRSHDFSY
LRLRPDHASRPLWISPSDGRIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSL
YAAVSVGLETDDIISVLDRLSKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQAD
ILQMLLNDSVIGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPNDVEAVFSAVIGGD
NEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNPDLDIDLKPST
QIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQW
RQQFLQWCTLQPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGR
EWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANW
MELSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHER
RGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDT
SIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYST
KRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIEVGDDAD
NSVGRGSNGHKRFKSKAVRGEGSLSGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKN
LKK
Download sequence
Identical sequences Q00578
YIL143C 4932.YIL143C YIL143C YIL143C YIL143c___KOG1123 IGBMC-0032-000 YIL143C

Jump to [ Top of page · Domain architecture · Domain assignment details ]