SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL146C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL146C   Protein: S000001408
Sequence length 529
Comment ECM37 SGDID:S000001408, Chr IX from 75773-74184, reverse complement, Verified ORF, "Non-essential protein of unknown function"
Sequence
MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS
PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE
EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD
EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL
FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL
KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC
RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV
KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT
IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL
Download sequence
Identical sequences A6ZVD0 B5VKG3 C7GUR3 C8ZAW6 P40458 W7Q1I2
YIL146C YIL146C YIL146C YIL146C YIL146C tr|A6ZVD0|A6ZVD0_YEAS7 4932.YIL146C YIL146C YIL146C YIL146C YR315 YIL146C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]