SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL146C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIL146C   Protein: S000001408
Sequence length 529
Comment ECM37 SGDID:S000001408, Chr IX from 75773-74184, reverse complement, Verified ORF, "Non-essential protein of unknown function"
Sequence
MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS
PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE
EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD
EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL
FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL
KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC
RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV
KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT
IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL
Download sequence
Identical sequences A6ZVD0 B5VKG3 C7GUR3 C8ZAW6 P40458 W7Q1I2
YIL146C YIL146C 4932.YIL146C YIL146C YIL146C YIL146C tr|A6ZVD0|A6ZVD0_YEAS7 YIL146C YIL146C YIL146C YR315 YIL146C

Jump to [ Top of page · Domain architecture · Domain assignment details ]