SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL148W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL148W
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-34
Family Ubiquitin-related 2.49e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YIL148W   Protein: S000001410
Sequence length 128
Comment RPL40A SGDID:S000001410, Chr IX from 68708-68715,69150-69528, Verified ORF, "Fusion protein, identical to Rpl40Bp, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes"
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ
LRPKKKLK
Download sequence
Identical sequences A6ZVC8 B3LRG8 C8ZAW5 G2WG04 H2AYM5 P0CH08 P0CH09
YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YIL148W YKR094C YIL148W YKR094C 4932.YIL148W 4932.YKR094C YIL148W YKR094C YIL148W SCRT_04110 SCRT_05321 YIL148W YKR094C YIL148W YKR094C tr|A6ZVC8|A6ZVC8_YEAS7 YIL148W 3u5e.m 3u5i.m 4b6a.m YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W

Jump to [ Top of page · Domain architecture · Domain assignment details ]