SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL159W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL159W
Domain Number 1 Region: 819-828,881-1284
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.35e-92
Family Formin homology 2 domain (FH2 domain) 0.000000106
Further Details:      
 
Domain Number 2 Region: 102-479
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000279
Family Diap1 N-terninal region-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
membrane coat 2.107 29.29
transferase complex 1.423 23.98
trans-Golgi network 1.793 19.11
cytosol 1.301 13.3
side of membrane 1.701 12.74
extrinsic component of plasma membrane 1.992 12.34
chromosomal part 1.477 11.08
endocytic vesicle 1.433 10.75
clathrin-coated vesicle 2.107 10.75
adherens junction 1.365 9.56

Protein sequence

External link(s) Locus: YIL159W   Protein: S000001421
Sequence length 1375
Comment BNR1 SGDID:S000001421, Chr IX from 41825-45952, Verified ORF, "Formin, nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables, functionally redundant with BNI1"
Sequence
MDSSPNKKTYRYPRRSLSLHARDRVSEARKLEELNLNDGLVAAGLQLVGVALEKQGTGSH
IYMKQKNFSANDVSSSPMVSEEVNGSEMDFNPKCMPQDASLVERMFDELLKDGTFFWGAA
YKNLQNISLRRKWLLICKIRSSNHWGKKKVTSSTTYSTHLATNELAENAHFLDGLVRNLS
TGGMKLSKALYKLEKFLRKQSFLQLFLKDEIYLTTLIEKTLPLISKELQFVYLRCFKILM
NNPLARIRALHSEPLIRWFTELLTDQNSNLKCQLLSMELLLLLTYVEGSTGCELIWDQLS
ILFTDWLEWFDKILADDIAIHSSLYLNWNQLKIDYSTTFLLLINSILQGFNNKTALEILN
FLKKNNIHNTITFLELAYKDDPNSVVIMEQIKQFKSKESAIFDSMIKTTNDTNSLHPTKD
IARIESEPLCLENCLLLKAKDSPVEAPINEIIQSLWKILDSQKPYSESIKLLKLINSLLF
YLIDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDSLQSDEIARRAVTEIDDLNAKIS
HLNEKLNLVENHDKDHLIAKLDESESLISLKTKEIENLKLQLKATKKRLDQITTHQRLYD
QPPSLASSNLSIAGSIIKNNSHGNIIFQNLAKKQQQQQKISLPKRSTSLLKSKRVTSLSS
YLTDANNENESQNESEDKSKDSLFQRSTSTINFNIPSMKNITNMQNVSLNSILSELEFSN
SLGTQPNYQSSPVLSSVSSSPKLFPRLSSDSLDNGIQLVPEVVKLPQLPPPPPPPPPPPL
PQSLLTEAEAKPDGVSCIAAPAPPPLPDLFKTKTCGAVPPPPPPPPLPESLSMNKGPSNH
DLVTPPAPPLPNGLLSSSSVSINPTTTDLKPPPTEKRLKQIHWDKVEDIKDTLWEDTFQR
QETIKELQTDGIFSQIEDIFKMKSPTKIANKRNAESSIALSSNNGKSSNELKKISFLSRD
LAQQFGINLHMFSQLSDMEFVMKVLNCDNDIVQNVNILKFFCKEELVNIPKSMLNKYEPY
SQGKDGKAVSDLQRADRIFLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDA
ISHLNRSPKFKSLMFIITEIGNHMNKRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKV
IRIKYPDIYGFVDDLKNIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDP
RDQIIKKVKFKINRAKTKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEF
LAMFKKCAKENIEKEEMERVYEQRKSLLDMRTSSNKKSNGSDENDGEKVNRDAVDLLISK
LREVKKDPEPLRRRKSTKLNEIAINVHEGDVKTRKDEDHVLLERTHAMLNDIQNI
Download sequence
Identical sequences N1P0Y3 P40450
4932.YIL159W YIL159W YIL159W YIL159W YIL159W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]