SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YIL170W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL170W
Domain Number 1 Region: 1-412
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-53
Family LacY-like proton/sugar symporter 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.417 14.48
vacuolar part 1.567 14.15
brush border membrane 1.487 11.03
clathrin-coated vesicle 1.989 10.1
presynapse 1.758 9.56
secretory vesicle 1.539 8.53
exocytic vesicle 2.03 7.81
lytic vacuole 1.553 7.12
intrinsic component of organelle membrane 2.016 6.26
synapse part 1.419 5.81
Biological Process IC (bits) H-Score
nucleobase-containing compound transport 2.039 39.45
ion transport 1.47 36.53
transmembrane transport 1.581 31.84
secretion 1.506 22.79
cellular chemical homeostasis 1.499 16.18
inorganic ion homeostasis 1.494 16.18
cation homeostasis 1.508 16.18
vacuole organization 2.183 16.18
response to organic cyclic compound 1.42 12.27
response to drug 1.512 12.02

Protein sequence

External link(s) Locus: YIL170W   Protein: S000001432
Sequence length 457
Comment HXT12 SGDID:S000001432, Chr IX from 19847-21220, pseudogene, "Possible pseudogene in strain S288C; YIL170W/HXT12 and the adjacent ORF, YIL171W, together encode a non-functional member of the hexose transporter family"
Sequence
MGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGR
IISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQ
WRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYD
TIKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSV
GLKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWP
QGSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAAN
WMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGV
PAWKSASWVPPERRTADYDADAIDHDNRPIYKRFFSS
Download sequence
Identical sequences P40441
YIL170W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]