SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YIL170W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL170W
Domain Number 1 Region: 1-412
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-53
Family LacY-like proton/sugar symporter 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.377 14.65
vacuolar part 1.526 14.09
cell projection membrane 1.808 11.21
clathrin-coated vesicle 1.946 10.05
presynapse 1.715 9.7
transport vesicle 1.738 9.64
secretory vesicle 1.491 8.6
exocytic vesicle 1.966 7.78
lytic vacuole 1.526 7.14
brush border 1.374 6.86
Biological Process IC (bits) H-Score
carbohydrate transport 2.21 61.71
nucleobase-containing compound transport 2.03 39.18
ion transport 1.48 35.3
transmembrane transport 1.589 31.84
secretion 1.494 23.86
synaptic vesicle cycle 2.21 17.92
neurotransmitter transport 2.183 17.92
cation homeostasis 1.52 16.07
inorganic ion homeostasis 1.505 16.07
cellular chemical homeostasis 1.503 16.07

Protein sequence

External link(s) Locus: YIL170W   Protein: S000001432
Sequence length 457
Comment HXT12 SGDID:S000001432, Chr IX from 19847-21220, pseudogene, "Possible pseudogene in strain S288C; YIL170W/HXT12 and the adjacent ORF, YIL171W, together encode a non-functional member of the hexose transporter family"
Sequence
MGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGR
IISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQ
WRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYD
TIKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSV
GLKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWP
QGSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAAN
WMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGV
PAWKSASWVPPERRTADYDADAIDHDNRPIYKRFFSS
Download sequence
Identical sequences P40441
YIL170W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]