SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL170W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL170W
Domain Number 1 Region: 1-412
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-53
Family LacY-like proton/sugar symporter 0.029
Further Details:      
 

Protein sequence

External link(s) Locus: YIL170W   Protein: S000001432
Sequence length 457
Comment HXT12 SGDID:S000001432, Chr IX from 19847-21220, pseudogene, "Possible pseudogene in strain S288C; YIL170W/HXT12 and the adjacent ORF, YIL171W, together encode a non-functional member of the hexose transporter family"
Sequence
MGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGR
IISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQ
WRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYD
TIKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSV
GLKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWP
QGSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAAN
WMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGV
PAWKSASWVPPERRTADYDADAIDHDNRPIYKRFFSS
Download sequence
Identical sequences P40441
YIL170W

Jump to [ Top of page · Domain architecture · Domain assignment details ]