SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL170W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL170W
Domain Number 1 Region: 1-412
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-53
Family LacY-like proton/sugar symporter 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
clathrin-coated vesicle 1.877 13.61
cell projection membrane 1.528 11.05
secretory granule 1.827 9.35
vacuole 1.428 8.86
brush border 1.481 8.21
coated vesicle 1.745 8.06
cytoplasmic vesicle membrane 1.923 7.95
transport vesicle 2.075 7.66
synapse part 1.513 6.53
sperm part 2.208 6.33

Protein sequence

External link(s) Locus: YIL170W   Protein: S000001432
Sequence length 457
Comment HXT12 SGDID:S000001432, Chr IX from 19847-21220, pseudogene, "Possible pseudogene in strain S288C; YIL170W/HXT12 and the adjacent ORF, YIL171W, together encode a non-functional member of the hexose transporter family"
Sequence
MGLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGR
IISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQ
WRVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYD
TIKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSV
GLKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWP
QGSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAAN
WMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGV
PAWKSASWVPPERRTADYDADAIDHDNRPIYKRFFSS
Download sequence
Identical sequences P40441
YIL170W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]