SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL171W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL171W   Protein: S000001433
Sequence length 109
Comment YIL171W SGDID:S000001433, Chr IX from 19515-19844, pseudogene, "Possible pseudogene in strain S288C; YIL171W and the adjacent ORF, YIL170W/HXT12, together encode a non-functional member of the hexose transporter family"
Sequence
MSGVNNTSANDLSTTESNSNSAVGAPSVKTEHGDSKDSLNLDATEAPIDLPQKPLSAYTT
VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKKTTRGLTTYRK
Download sequence
Identical sequences P40440
YIL171W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]