SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIL171W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIL171W   Protein: S000001433
Sequence length 109
Comment YIL171W SGDID:S000001433, Chr IX from 19515-19844, pseudogene, "Possible pseudogene in strain S288C; YIL171W and the adjacent ORF, YIL170W/HXT12, together encode a non-functional member of the hexose transporter family"
Sequence
MSGVNNTSANDLSTTESNSNSAVGAPSVKTEHGDSKDSLNLDATEAPIDLPQKPLSAYTT
VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKKTTRGLTTYRK
Download sequence
Identical sequences P40440
YIL171W

Jump to [ Top of page · Domain architecture · Domain assignment details ]