SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YIR008C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIR008C
Domain Number 1 Region: 14-368
Classification Level Classification E-value
Superfamily Prim-pol domain 1.7e-110
Family PriA-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
nucleotidyltransferase activity 1.652 30.57
Cellular Component IC (bits) H-Score
replication fork 2.197 36.71
chromosomal part 1.478 5.65
nuclear chromosome 1.723 5.1
Biological Process IC (bits) H-Score
DNA-dependent DNA replication 2.082 27.9
RNA biosynthetic process 1.536 3.51

Protein sequence

External link(s) Locus: YIR008C   Protein: S000001447
Sequence length 409
Comment PRI1 SGDID:S000001447, Chr IX from 374303-373074, reverse complement, Verified ORF, "Subunit of DNA primase, which is required for DNA synthesis and double-strand break repair"
Sequence
MTNSVKTNGPSSSDMEYYYKSLYPFKHIFNWLNHSPKPSRDMINREFAMAFRSGAYKRYN
SFNSVQDFKAQIEKANPDRFEIGAIYNKPPRERDTLLKSELKALEKELVFDIDMDDYDAF
RTCCSGAQVCSKCWKFISLAMKITNTALREDFGYKDFIWVFSGRRGAHCWVSDKRARALT
DVQRRNVLDYVNVIRDRNTDKRLALKRPYHPHLARSLEQLKPFFVSIMLEEQNPWEDDQH
AIQTLLPALYDKQLIDSLKKYWLDNPRRSSKEKWNDIDQIATSLFKGPKQDSHIIKLREC
KEDLVLMTLYPKLDVEVTKQTIHLLKAPFCIHPATGNVCVPIDESFAPEKAPKLIDLQTE
MEKNNDVSLTALQPFINQFQAYVSSLLKNELGSVKREREDDDEPASLDF
Download sequence
Identical sequences N1P491 P10363
YIR008C YIR008C YIR008C YIR008c___KOG2851 4932.YIR008C YIR008C YIR008C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]