SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIR008C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIR008C
Domain Number 1 Region: 14-368
Classification Level Classification E-value
Superfamily Prim-pol domain 1.7e-110
Family PriA-like 0.00079
Further Details:      
 

Protein sequence

External link(s) Locus: YIR008C   Protein: S000001447
Sequence length 409
Comment PRI1 SGDID:S000001447, Chr IX from 374303-373074, reverse complement, Verified ORF, "Subunit of DNA primase, which is required for DNA synthesis and double-strand break repair"
Sequence
MTNSVKTNGPSSSDMEYYYKSLYPFKHIFNWLNHSPKPSRDMINREFAMAFRSGAYKRYN
SFNSVQDFKAQIEKANPDRFEIGAIYNKPPRERDTLLKSELKALEKELVFDIDMDDYDAF
RTCCSGAQVCSKCWKFISLAMKITNTALREDFGYKDFIWVFSGRRGAHCWVSDKRARALT
DVQRRNVLDYVNVIRDRNTDKRLALKRPYHPHLARSLEQLKPFFVSIMLEEQNPWEDDQH
AIQTLLPALYDKQLIDSLKKYWLDNPRRSSKEKWNDIDQIATSLFKGPKQDSHIIKLREC
KEDLVLMTLYPKLDVEVTKQTIHLLKAPFCIHPATGNVCVPIDESFAPEKAPKLIDLQTE
MEKNNDVSLTALQPFINQFQAYVSSLLKNELGSVKREREDDDEPASLDF
Download sequence
Identical sequences N1P491 P10363
YIR008C 4932.YIR008C YIR008C YIR008C YIR008C YIR008c___KOG2851 YIR008C

Jump to [ Top of page · Domain architecture · Domain assignment details ]