SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIR017W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIR017W-A   Protein: S000028799
Sequence length 199
Comment YIR017W-A SGDID:S000028799, Chr IX from 383563-384162, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MFRLLMSFNNFKDLISLMSLSFAFQNSFSLFNCSIRSRSLLICVFKFCSLFMFSKFFCFL
RMRNRCDASVFFLLRSCLILSSSLEVLTGASSSFTTTAVVAATFPFLGSRSFLNCETSWP
LFIMLMSSSALPLLTSSNDSKREPSSESLDIRFCRCSERLFTFIPFLLAMSMFVDFFSHP
CFALILTNKTICLRNYHWL
Download sequence
Identical sequences C8ZAR6 Q03885
YIR017W-A YIR017W-A YIR017W-A 4932.YIR017W-A YIR017W-A YIR017W-A YIR017W-A YIR017W-A YIR017W-A YIR017W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]