SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YIR018C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YIR018C-A   Protein: S000028837
Sequence length 45
Comment YIR018C-A SGDID:S000028837, Chr IX from 385698-385561, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry"
Sequence
MPSDYTSHYPVILIKKKKKKIAGMYRHSKRYLEIMSTASAQFVGN
Download sequence
Identical sequences Q3E7Z3
4932.YIR018C-A YIR018C-A YIR018C-A YIR018C-A YIR018C-A YIR018C-A YIR018C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]