SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIR018C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YIR018C-A   Protein: S000028837
Sequence length 45
Comment YIR018C-A SGDID:S000028837, Chr IX from 385698-385561, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry"
Sequence
MPSDYTSHYPVILIKKKKKKIAGMYRHSKRYLEIMSTASAQFVGN
Download sequence
Identical sequences Q3E7Z3
YIR018C-A 4932.YIR018C-A YIR018C-A YIR018C-A YIR018C-A YIR018C-A YIR018C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]